DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-38

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_506983.1 Gene:gst-38 / 185299 WormBaseID:WBGene00001786 Length:209 Species:Caenorhabditis elegans


Alignment Length:214 Identity:66/214 - (30%)
Similarity:106/214 - (49%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPT--MPMGQMPVLEVDGKRVHQSI 111
            ||.|.||:.:...|..|.:||...|:|||.|:|.:||...|..  .|..|:|:||||||.:.||.
 Worm     3 SYKLTYFDGRGAGELCRQIFAAAEQKYEDNRLTDEEWEKFKAAGKTPYNQLPMLEVDGKPLAQSH 67

  Fly   112 SMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVS----YEPEDEIKEKKLVTLNAEV 172
            :|||:||:..|..|.:.||:.|::.:.|...|:...:..:::    |...|   .:.|.|  :..
 Worm    68 AMARYLAREFGFNGKSRWEEAQVNSLADQYKDYYAEARPYLAVKLGYTEGD---AEALYT--SVY 127

  Fly   173 IP-------FYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVD 230
            :|       |::..|:.:   ..|.|....||:.|:..|..:..:....|.||....|.::...:
 Worm   128 LPVFKKHYGFFVNALKAS---GSGFLVGNSLTFIDLLVAQHSADLLGREKSDLFNDVPEMKAHSE 189

  Fly   231 AVNALEPIKAWIEKRPVTE 249
            .|.::..||.|||.||.::
 Worm   190 KVQSIPQIKKWIETRPASD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 32/70 (46%)
PTZ00057 52..245 CDD:173353 62/205 (30%)
GST_C_Sigma_like 129..232 CDD:198301 22/113 (19%)
gst-38NP_506983.1 GST_N_Sigma_like 4..75 CDD:239337 32/70 (46%)
PTZ00057 6..207 CDD:173353 64/208 (31%)
GST_C_Sigma_like 85..191 CDD:198301 22/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.