DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-8

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_494884.1 Gene:gst-8 / 184364 WormBaseID:WBGene00001756 Length:206 Species:Caenorhabditis elegans


Alignment Length:209 Identity:72/209 - (34%)
Similarity:110/209 - (52%) Gaps:16/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |.|.||.::...|.:|.:|.|..|.:||.|::.:||.|:|||.|.||:|:||||||.:.||.|:|
 Worm     4 YKLSYFPIRGAGEVIRQIFVYAGQSFEDHRISIEEWAAVKPTTPFGQLPLLEVDGKVLPQSHSIA 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEV-IP---- 174
            ||||:..|:.|...||:.|::.:.|...|:|.....:|..:.  ...|..|..|:.:| :|    
 Worm    69 RFLARQFGINGKCAWEEAQVNSIADQFKDYRNEVRPYVMVKM--GFAEGDLDALSKDVFLPGFKK 131

  Fly   175 ---FYLEKLEQTVKDNDGHLALGKLTWADVYFAGIT-DYMNYMVKRDLLEPYPALRGVVDAVNAL 235
               |....|:..   ..|:|....||:.|:..|..| |.::  ....|||.:|..:...:.|::.
 Worm   132 HYGFIYNFLKTA---GSGYLVGDSLTFVDLLIAQHTADILS--TDPALLEEFPQFKAHQEKVHSN 191

  Fly   236 EPIKAWIEKRPVTE 249
            ..||.|:|.||.|:
 Worm   192 ANIKKWLETRPETQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 35/68 (51%)
PTZ00057 52..245 CDD:173353 68/201 (34%)
GST_C_Sigma_like 129..232 CDD:198301 26/111 (23%)
gst-8NP_494884.1 GST_N_Sigma_like 4..73 CDD:239337 35/68 (51%)
PTZ00057 6..206 CDD:173353 71/207 (34%)
GST_C_Sigma_like 83..188 CDD:198301 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.