DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-22

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_507095.1 Gene:gst-22 / 180088 WormBaseID:WBGene00001770 Length:218 Species:Caenorhabditis elegans


Alignment Length:227 Identity:71/227 - (31%)
Similarity:106/227 - (46%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRV---------TRDEWPALKPTMPMGQMPVLEVDG 104
            ||.|.||:.....|..|.||..|...|||||:         ..||:.|||...|.|:..||.:||
 Worm     3 SYKLTYFDACGFGESARMLFHLGGVPYEDVRLPTINAVPGFQSDEFSALKDKTPFGRFTVLSIDG 67

  Fly   105 KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEP-EDEIKEKKL--- 165
            ..:.||.::.|:||:..|..|.||.::...|.:||..|::      :.|..| .|.:|..|.   
 Worm    68 FDLAQSSAIHRYLARKFGYAGKTPEDEAFADSIVDQFNEY------YASLHPYRDAVKTGKTMEE 126

  Fly   166 -------VTLNAEVIPFYLEKLEQTVKDN-DGHLALGKLTWADVYFAGITDYMNYMVKRDLLEP- 221
                   |.:.|:.:.|.:  |.:.:|:| .|.|....|||||:.   :.|::..:.....|:| 
 Worm   127 VKQIHDKVYIPAKNLMFKI--LTRILKENKSGFLVGDGLTWADLV---VADHLYTLTNLKELDPE 186

  Fly   222 ---YPALRGVVDAVNALEPIKAWIEKRPVTEV 250
               :..||...:.:..|..:|.:||.||||.|
 Worm   187 DPIHLTLRKFQEKIFNLTELKDYIETRPVTLV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 29/77 (38%)
PTZ00057 52..245 CDD:173353 64/217 (29%)
GST_C_Sigma_like 129..232 CDD:198301 27/118 (23%)
gst-22NP_507095.1 GST_N_Sigma_like 4..82 CDD:239337 29/77 (38%)
PTZ00057 6..213 CDD:173353 64/217 (29%)
GST_C_Sigma_like 92..200 CDD:198301 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.