DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and F55A11.6

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001256366.1 Gene:F55A11.6 / 179613 WormBaseID:WBGene00010079 Length:297 Species:Caenorhabditis elegans


Alignment Length:190 Identity:44/190 - (23%)
Similarity:85/190 - (44%) Gaps:24/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISM 113
            :|||..|:.....:.:|.:|......||...|.||::  :....|...:|.||::.::....:|:
 Worm    90 TYTLHDFDDGEECKVVRMIFQMSRVPYEFKHVHRDDY--ILEDYPFYALPTLEMNERKYGSVLSI 152

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV-------SYEPEDEIKEKKLVTLNAE 171
            .|.||....|.|.|.::|.|:|.:.:.:.:.|:..:.::       .:..::|..|        |
 Worm   153 CRHLAWRYNLSGKTAYDDAQVDDIAEKVFEVRMKIKNWIDHIEHAADHACDEECTE--------E 209

  Fly   172 VIPFYLEK-----LEQTVKDNDGHLALG-KLTWADVYFAGITDYMNYMVKRDLLEPYPAL 225
            :.|..|..     ||:.:|.......:| .:||.|:..|.:.:.:.|. :..||:.:|.|
 Worm   210 IAPRILTNTLFPCLERMLKSAASCWLVGHTMTWVDLLVACLVNPIIYH-RPKLLQDFPLL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 18/68 (26%)
PTZ00057 52..245 CDD:173353 42/187 (22%)
GST_C_Sigma_like 129..232 CDD:198301 22/110 (20%)
F55A11.6NP_001256366.1 GST_N_3 93..163 CDD:379176 17/71 (24%)
GST_C_Sigma_like 169..275 CDD:198301 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.