DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-41

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_504894.1 Gene:gst-41 / 179127 WormBaseID:WBGene00001789 Length:210 Species:Caenorhabditis elegans


Alignment Length:198 Identity:57/198 - (28%)
Similarity:105/198 - (53%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFYFNVKALAEPLRYLFAYGNQEYEDVRV--TRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |:||:::...|.:|.|......::||:|.  ..:||..||.||..||:|..:|||:.:.|:.::.
 Worm     6 LYYFSIRGYGEYIRLLLIDNGIKFEDIRFPWQSNEWAELKKTMKFGQVPCYKVDGQEIVQAGAIM 70

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLEK 179
            |.|.:...|.|:...|...:|::.|.|.|.||   :::.|...||...:.:|.   :.:|..||:
 Worm    71 RHLGRVHKLNGSNEQEATFLDMLFDAIRDVRL---KYIRYVYFDEGSREDMVN---KTLPESLER 129

  Fly   180 LEQTVKDNDGHLALG-KLTWAD-VYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEPIKAWI 242
            ||...:.:.|...:| ||::.| :.|..:..|  :::...:|:.:|||:...:.:.....:|.::
 Worm   130 LECQFEIHPGDFIIGNKLSYTDYILFEELDIY--HVLDGKILDKFPALKAFWERMWQRPNLKPYL 192

  Fly   243 EKR 245
            |||
 Worm   193 EKR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 24/68 (35%)
PTZ00057 52..245 CDD:173353 55/196 (28%)
GST_C_Sigma_like 129..232 CDD:198301 27/104 (26%)
gst-41NP_504894.1 Thioredoxin_like 3..76 CDD:294274 24/69 (35%)
PTZ00057 6..201 CDD:173353 57/198 (29%)
GST_C_Pi 84..208 CDD:198319 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.