DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-2

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_501847.1 Gene:gst-2 / 177884 WormBaseID:WBGene00001750 Length:188 Species:Caenorhabditis elegans


Alignment Length:201 Identity:65/201 - (32%)
Similarity:101/201 - (50%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |.|..|:|:.|.|.:|.||..|:..:||.||:|:|:.:||..:|.||:||||:||..:.||.|:.
 Worm     4 YKLMCFDVRGLGEVIRQLFYLGDVSFEDFRVSREEFKSLKSNLPSGQLPVLEIDGVMISQSASIG 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQF----VSYEPEDEIKEKKLVTLNAEVIPF 175
            ||||:..|..|.||.|::|:|.::|...||.|:..||    :...||.|.:..|...:...:..:
 Worm    69 RFLARQYGYSGKTPTEEMQVDSIIDLFKDFMLTFRQFFFAVIHGYPEYEKERMKRDIVKPAIKNY 133

  Fly   176 YLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEPIKA 240
            ::...:..::...|.|....|||||:..|                         |.::.|..|:.
 Worm   134 FIALNKILLRSKSGFLVGDDLTWADLQIA-------------------------DNLSTLINIRL 173

  Fly   241 WIEKRP 246
            :.||.|
 Worm   174 FAEKEP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 33/68 (49%)
PTZ00057 52..245 CDD:173353 62/196 (32%)
GST_C_Sigma_like 129..232 CDD:198301 22/106 (21%)
gst-2NP_501847.1 GST_N_Sigma_like 4..73 CDD:239337 33/68 (49%)
GST_C_Sigma_like 84..187 CDD:198301 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.