DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-3

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_501846.1 Gene:gst-3 / 177883 WormBaseID:WBGene00001751 Length:207 Species:Caenorhabditis elegans


Alignment Length:207 Identity:74/207 - (35%)
Similarity:113/207 - (54%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |.|.|||.:.|||..|.||.....|:||.|:..:::..||||.|.||:|:|.:||.:..||.::|
 Worm     4 YKLTYFNARGLAEISRQLFHMAGVEFEDERINEEKFSQLKPTFPSGQVPILCIDGAQFSQSTAIA 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV----SYEPEDEIK--EKKLVTLNAEVI 173
            |:||:..|..|.|..|:||.|.||||..||..|..:||    |.|.|:.:|  .::::....:..
 Worm    69 RYLARKFGFVGQTAEEELQADEVVDTFKDFIESFRKFVIAVLSGESEEILKNIREEVIKPAVKTY 133

  Fly   174 PFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLL--EPYPALRGVVDAVNALE 236
            ..||:.:.:  |.:.|:|...:|||||:.   |.|.:..::..:||  |....|:...:.:....
 Worm   134 TAYLKAILE--KSSSGYLVGNELTWADLV---IADNLTTLINAELLDIENDKLLKEFREKIIETP 193

  Fly   237 PIKAWIEKRPVT 248
            .:|.|:.|||.|
 Worm   194 KLKEWLAKRPET 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 31/68 (46%)
PTZ00057 52..245 CDD:173353 69/200 (35%)
GST_C_Sigma_like 129..232 CDD:198301 33/110 (30%)
gst-3NP_501846.1 GST_N_Sigma_like 4..73 CDD:239337 31/68 (46%)
PTZ00057 6..207 CDD:173353 73/205 (36%)
GST_C_Sigma_like 83..189 CDD:198301 33/110 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.