DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-40

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_499981.1 Gene:gst-40 / 176900 WormBaseID:WBGene00001788 Length:216 Species:Caenorhabditis elegans


Alignment Length:210 Identity:62/210 - (29%)
Similarity:110/210 - (52%) Gaps:33/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KHSYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWP-ALKPTMPMGQMPVLEVDGKR--VH 108
            ||.|.|:|.|::..|||:|.:|.:...::||.|:.:.::. |:|...||.|:|.:|:||.:  :.
 Worm     6 KHRYKLYYVNMRGRAEPIRLVFHFLGVDFEDYRMDKGDFTGAMKDKAPMKQLPFIEIDGGKTTLC 70

  Fly   109 QSISMARFLAKTV----GLCGATPWEDLQIDIVVDTIND-FRLSSEQFVSYEPEDEIKEKKLVTL 168
            |::|:.|:|||::    ...|||..:..::|::.|...| |:|::  ...|.| |.||:..:.|.
 Worm    71 QTVSICRYLAKSIQPDRWFGGATKTDSAKVDMMADGFADLFQLAA--MAKYAP-DPIKDSMMGTY 132

  Fly   169 NAEVIPFYLEKLEQTVKDNDGHLALGK-LTWADVYFAGITDYMN----------------YMVKR 216
            ...:.| .||.::..:|.:.|...:|| :.|.|||..|:...::                |:..|
 Worm   133 KESIGP-KLENMQDLLKKSKGEYFVGKSIHWCDVYILGVLQALDESDDGVFDNLPELREYYLRMR 196

  Fly   217 DLLEPYPALRGVVDA 231
            :|    |.|:..:||
 Worm   197 NL----PELKEYIDA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 25/71 (35%)
PTZ00057 52..245 CDD:173353 59/205 (29%)
GST_C_Sigma_like 129..232 CDD:198301 30/121 (25%)
gst-40NP_499981.1 GST_N_Sigma_like 9..81 CDD:239337 25/71 (35%)
PTZ00057 11..214 CDD:173353 59/205 (29%)
GST_C_Sigma_like 96..195 CDD:198301 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.