DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-19

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496864.1 Gene:gst-19 / 175010 WormBaseID:WBGene00001767 Length:207 Species:Caenorhabditis elegans


Alignment Length:209 Identity:59/209 - (28%)
Similarity:101/209 - (48%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISM 113
            ||...||..:.|.||:|.||...:..::|.|.:.:||.|:|...||||:|:|.|||..:.||.::
 Worm     3 SYKFTYFPFRGLGEPVRLLFHLADCPFKDERFSFEEWGAVKSKSPMGQLPILGVDGLEIPQSAAI 67

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIP---F 175
            .|:||...|..|.||.:...:|.|||...||.:..::|:..:...:.:|:....::..|:|   .
 Worm    68 LRYLALKFGFAGKTPEDRAWVDAVVDRFKDFFVEFKKFLVAKRGGKSEEEVAKVVSESVVPAMES 132

  Fly   176 YLEKLEQTV-KDNDGHLALGKLTWADVYFAGITDYMNYMVKRDL----LEPYPALRGVVDAVNAL 235
            |.:.|...: :...|.|....:|:||:....     |....|:.    ....|.|..:::.|.:.
 Worm   133 YFKLLNGLLERSKSGFLIGNSITYADLVVVN-----NLETLRNFGFLNASEQPKLTALLEKVYSQ 192

  Fly   236 EPIKAWIEKRPVTE 249
            ..||.::..|..::
 Worm   193 PGIKEYVSSRTASD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 28/68 (41%)
PTZ00057 52..245 CDD:173353 56/200 (28%)
GST_C_Sigma_like 129..232 CDD:198301 21/110 (19%)
gst-19NP_496864.1 GST_N_Sigma_like 4..72 CDD:239337 27/67 (40%)
PTZ00057 8..205 CDD:173353 57/201 (28%)
GST_C_Sigma_like 83..189 CDD:198301 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.