DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-16

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496863.1 Gene:gst-16 / 175009 WormBaseID:WBGene00001764 Length:208 Species:Caenorhabditis elegans


Alignment Length:213 Identity:69/213 - (32%)
Similarity:107/213 - (50%) Gaps:20/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDE-WPALKPTMPMGQMPVLEVDGKRVHQSIS 112
            ||.|.||..:.|.||:|.||.....::|:||:..|: |..:|.:.||.|:|||.:||..:.||.:
 Worm     3 SYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGA 67

  Fly   113 MARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV----SYEPEDEIKEKK----LVTLN 169
            :.|:||:..|..|.||.|:..:|.|.|...||....::|.    |.:..:|:::.:    |...|
 Worm    68 ILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGKSAEEVEKFRSEFFLPARN 132

  Fly   170 A--EVIPFYLEKLEQTVKDNDGHLALGKLTWAD-VYFAGITDYMNYMVKRDLLEPYPALRGVVDA 231
            .  .::...||      |.|.|.|....:|:|| |....:....||.:..:  ..:..|..:.:.
 Worm   133 TYFNILNGLLE------KSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDE--SEFTKLAALREK 189

  Fly   232 VNALEPIKAWIEKRPVTE 249
            ||:...||.:|.||||||
 Worm   190 VNSYPGIKEYIAKRPVTE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 28/69 (41%)
PTZ00057 52..245 CDD:173353 61/204 (30%)
GST_C_Sigma_like 129..232 CDD:198301 24/113 (21%)
gst-16NP_496863.1 GST_N_Sigma_like 4..74 CDD:239337 28/69 (41%)
PTZ00057 6..208 CDD:173353 67/210 (32%)
GST_C_Sigma_like 84..190 CDD:198301 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.