DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-20

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496858.1 Gene:gst-20 / 175008 WormBaseID:WBGene00001768 Length:207 Species:Caenorhabditis elegans


Alignment Length:206 Identity:66/206 - (32%)
Similarity:104/206 - (50%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEV-DGKRVHQSISM 113
            |..:|||.:.|.:..|.|||....:|||:|:...:|||.||.||.|||||||: .|.::.||:::
 Worm     4 YKFYYFNGRGLGDVSRQLFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAI 68

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQF------VSYEPEDEIKEKKLVTLNAEV 172
            ||:|||..|..|.|..|....|.::|...||....:.:      |.....:|.|:|.|:....:.
 Worm    69 ARYLAKKFGYAGKTDEEAALADALIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKF 133

  Fly   173 IPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVK--RDLLEPYPALRGVVDAVNAL 235
            :....:.|:.::   .|.|..|.||:||:.   |.|.|..::.  .:.|..||.::.....|:.:
 Worm   134 LTIIGKFLKLSI---SGFLFSGGLTYADLM---ICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGI 192

  Fly   236 EPIKAWIEKRP 246
            ..|:..:|..|
 Worm   193 PEIRKHLESSP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 33/69 (48%)
PTZ00057 52..245 CDD:173353 64/201 (32%)
GST_C_Sigma_like 129..232 CDD:198301 24/110 (22%)
gst-20NP_496858.1 GST_N_Sigma_like 4..74 CDD:239337 33/69 (48%)
PTZ00057 6..199 CDD:173353 63/198 (32%)
GST_C_Sigma_like 84..189 CDD:198301 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167531
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.