DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-7

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_494883.1 Gene:gst-7 / 173842 WormBaseID:WBGene00001755 Length:206 Species:Caenorhabditis elegans


Alignment Length:227 Identity:70/227 - (30%)
Similarity:108/227 - (47%) Gaps:54/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |.:.||.::...|..|.:.||..|::||.|:.::||||:||:.|.||:|:||||||.:.||.::|
 Worm     4 YKVSYFPIRGAGEIARQILAYAGQDFEDNRIPKEEWPAVKPSTPFGQLPLLEVDGKVLAQSHAIA 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLEK 179
            |:||:..|:.|...||:.|::.|.|...|:                       || ||.|:::.|
 Worm    69 RYLARQFGINGKCAWEEAQVNSVADQFKDY-----------------------LN-EVRPYFMVK 109

  Fly   180 -------LEQTVKD--------------------NDGHLALGKLTWADVYFAGIT-DYMNYMVKR 216
                   |:...||                    ..|:|....||:.|:..|..| |.:  ....
 Worm   110 MGFAEGDLDALAKDVFLPGFKKHYGFFANFLKSAGSGYLVGDSLTFVDLLVAQHTADLL--AANA 172

  Fly   217 DLLEPYPALRGVVDAVNALEPIKAWIEKRPVT 248
            .||:.:|..:...:.|::...||.|:|.||||
 Worm   173 ALLDEFPQFKAHQEKVHSNANIKKWLETRPVT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 32/68 (47%)
PTZ00057 52..245 CDD:173353 65/220 (30%)
GST_C_Sigma_like 129..232 CDD:198301 26/130 (20%)
gst-7NP_494883.1 GST_N_Sigma_like 4..73 CDD:239337 32/68 (47%)
PTZ00057 8..201 CDD:173353 65/218 (30%)
GST_C_Sigma_like 83..188 CDD:198301 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14387
orthoMCL 1 0.900 - - OOG6_100172
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.