DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-6

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_494882.2 Gene:gst-6 / 173841 WormBaseID:WBGene00001754 Length:206 Species:Caenorhabditis elegans


Alignment Length:208 Identity:61/208 - (29%)
Similarity:109/208 - (52%) Gaps:20/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |.|.||.::|.||..|.:|||..|:|.:..::.::|||.|...|.||:|:||||||.:.||.::|
 Worm     4 YKLVYFPLRARAEIARQIFAYAGQDYSEENLSFEQWPARKNNTPFGQLPILEVDGKPLGQSYAIA 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVS----YEPEDEIKEKKLVTLNAEV-IP 174
            |:||:..|:.|....|..::|.:.|...|:......:::    ::|.|:.:      |..:| :|
 Worm    69 RYLAREFGIAGQNDTEAAEVDAIADQFKDYLNDVSPYLTVLAGFKPGDKDQ------LRTDVFVP 127

  Fly   175 FY---LEKLEQTVKDNDGHLALG-KLTWADVYFAGITDYMNYMVKRDL--LEPYPALRGVVDAVN 233
            .:   .|..|..:..|.....:| .|||.|:.   |:.::..::.:||  :|.:..:......|.
 Worm   128 AFKKNFEFFENILASNHSGFFVGNSLTWVDLL---ISQHVQDILDKDLAVVEEFKKVLAHRKKVQ 189

  Fly   234 ALEPIKAWIEKRP 246
            :::.|:.:|..||
 Worm   190 SIDRIQKYIANRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 32/68 (47%)
PTZ00057 52..245 CDD:173353 58/203 (29%)
GST_C_Sigma_like 129..232 CDD:198301 21/113 (19%)
gst-6NP_494882.2 GST_N_Sigma_like 4..73 CDD:239337 32/68 (47%)
PTZ00057 6..203 CDD:173353 60/206 (29%)
GST_C_Sigma_like 84..188 CDD:198301 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14387
orthoMCL 1 0.900 - - OOG6_100172
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.