DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gstm1

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001361607.1 Gene:Gstm1 / 14862 MGIID:95860 Length:244 Species:Mus musculus


Alignment Length:233 Identity:60/233 - (25%)
Similarity:103/233 - (44%) Gaps:53/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLEVDG 104
            |.|:||:.|..|:|.|..|.:..|::.|.|        |.:|  |.....:|    .:|.| :||
Mouse     5 LGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQW--LNEKFKLGLDFPNLPYL-IDG 66

  Fly   105 K-RVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV--SYEPE---DEIKEK 163
            . ::.||.::.|:||:...|.|.|..|.::.|||.:.:.|.|:   |.:  .|.|:   ..:...
Mouse    67 SHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRM---QLIMLCYNPDFVAVPLPNP 128

  Fly   164 KLVTLNAEVI------------PFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNY 212
            .|.:|:.:|:            |.:|:.:.:.:|.....  |||..|    |||    ..|::.|
Mouse   129 LLGSLSLKVVTASCSLPQEKQKPEFLKTIPEKMKLYSEF--LGKRPW----FAGDKVTYVDFLAY 187

  Fly   213 -------MVKRDLLEPYPALRGVVDAVNALEPIKAWIE 243
                   |.:...|:.:|.||..:.....|:.|.|:::
Mouse   188 DILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 24/79 (30%)
PTZ00057 52..245 CDD:173353 60/233 (26%)
GST_C_Sigma_like 129..232 CDD:198301 29/130 (22%)
Gstm1NP_001361607.1 GST_N_Mu 3..84 CDD:239373 25/81 (31%)
GST_C_Mu 92..238 CDD:198318 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.