DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and LOC100490385

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_031755429.1 Gene:LOC100490385 / 100490385 -ID:- Length:218 Species:Xenopus tropicalis


Alignment Length:213 Identity:54/213 - (25%)
Similarity:104/213 - (48%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPA----LKPTMPMGQMPVLEVDGKRVHQS 110
            |||.|:.|:..||.:|.|.|..:..:|:..|...:|.:    .:.....|::|..:.....:.||
 Frog     4 YTLTYYPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAVFGRLPQFQNGDFVLCQS 68

  Fly   111 ISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPF 175
            .|:.|:||...||.|....|...||:|.|::.|.|....:|:.:..:::.|.|.|     |.:|.
 Frog    69 NSILRYLAHKHGLTGDNDEESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYL-----EALPQ 128

  Fly   176 YLEKLEQTV-KDNDG-HLALG-KLTWADVYFAGITDYM--NYMVKRDLLEPYPALRGVVDAVNAL 235
            .||..|:.: |:::| ...:| |:::||.   .:.|.:  :..:..:.|..:|.||..::.:.:.
 Frog   129 QLEFFERVLSKNHNGSKFVVGQKISYADY---NLVDLLQCHLDLSPECLSAFPLLRAYLERLVSQ 190

  Fly   236 EPIKAWI-----EKRPVT 248
            ..:..::     ::||:|
 Frog   191 PTLSDYLNSDARKRRPIT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 20/72 (28%)
PTZ00057 52..245 CDD:173353 49/206 (24%)
GST_C_Sigma_like 129..232 CDD:198301 27/107 (25%)
LOC100490385XP_031755429.1 Thioredoxin_like 3..78 CDD:412351 21/73 (29%)
GST_C_family 86..212 CDD:413470 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.