DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gsta5

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001116132.1 Gene:Gsta5 / 100042314 MGIID:3704339 Length:222 Species:Mus musculus


Alignment Length:216 Identity:52/216 - (24%)
Similarity:100/216 - (46%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EPIKHSYTLFYFNVKALAEPLRYLFAYGNQEYEDVRV-TRDEWPALKP--TMPMGQMPVLEVDGK 105
            :|:.|     :||.:...|.:|:|.|....|:|:..: :.::...||.  .:...|:|::|:||.
Mouse     4 KPVLH-----HFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGM 63

  Fly   106 RVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNA 170
            ::.|:.::..::|....|.|....|...||:..:.|.|......|.:...|:.  ||.|......
Mouse    64 KLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQ--KEAKTALAKD 126

  Fly   171 EVIPFYLEKLEQTVKDNDGH----LALGKLTWADVYFAGITDYMNYMVKRD--LLEPYPALRGVV 229
            .....||...|:.:|   ||    |...:||..||:   :.:.:.|:.:.|  ||.|:|.|:...
Mouse   127 RTKNRYLPAFEKVLK---GHGQDYLVGNRLTRVDVH---LLELLLYVEEFDASLLTPFPLLKAFK 185

  Fly   230 DAVNALEPIKAWI----EKRP 246
            ..:::|..:|.::    :::|
Mouse   186 SRISSLPNVKKFLHPGSQRKP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 16/71 (23%)
PTZ00057 52..245 CDD:173353 49/205 (24%)
GST_C_Sigma_like 129..232 CDD:198301 28/108 (26%)
Gsta5NP_001116132.1 PTZ00057 1..198 CDD:173353 51/206 (25%)
GST_N_Alpha 4..82 CDD:239375 19/82 (23%)
GST_C_family 86..220 CDD:295467 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.