DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6984 and Srlp

DIOPT Version :9

Sequence 1:NP_611187.1 Gene:CG6984 / 36926 FlyBaseID:FBgn0034191 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster


Alignment Length:275 Identity:64/275 - (23%)
Similarity:112/275 - (40%) Gaps:35/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSDLVLVKEHNGVREITLNHPK---TLNSLSLDMMCALQDALLKDKDNLDLRCVVLTAQGKIWSA 91
            |...:||::...:..|.:|.|:   .::||:...:|   ||....:.:......||...|..:.:
  Fly    45 PPKNILVEKDKNITLIGINRPQQRNAIDSLTASQLC---DAFANFEADDTSPVAVLYGVGGSFCS 106

  Fly    92 GHNLKELHNDPK--IQACVFQKLTDVINDIQR-LPVPVLGKVNGYAAAAGCQLVVSCDMVVCTK- 152
            |.::.|:..|.|  |...:..:....:...:| :..||:..:|||..|.|.:|.:.||:.|..: 
  Fly   107 GFDILEISTDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEES 171

  Fly   153 ------NSKFSTPGAGVGVFCSTPGVAVARIMSRPKSAYMLMTGLPVTGEEAYISGMVTKAVP-A 210
                  |.:|..|....|.......:.::|.:.      :::||.||..:||:..|:|.:.|| .
  Fly   172 AVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALD------LILTGRPVGSQEAHDIGLVNRIVPTG 230

  Fly   211 EELDKEIEEITNAIKAKSRAVISLGKEFYYKQLAMS------QAEAFSAAQEKMCENFQLGDTKE 269
            ..|...:|..|...|...||:|......|......|      |.|....::|      .:.|.:.
  Fly   231 TALGNALELATCLAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSRE------IIEDMQN 289

  Fly   270 GIASFFEKRPPNWKH 284
            ||..|.:...|:..|
  Fly   290 GIKWFNQTFKPDTTH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6984NP_611187.1 crotonase-like 24..283 CDD:304874 63/272 (23%)
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 52/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.