DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6984 and Dci

DIOPT Version :10

Sequence 1:NP_611187.1 Gene:CG6984 / 36926 FlyBaseID:FBgn0034191 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster


Alignment Length:83 Identity:22/83 - (26%)
Similarity:32/83 - (38%) Gaps:21/83 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2242 WKVYRKMMGPEIEKFSSSVPKSPIRELLEMEPETAKFGKPEKLTDGRRVRVTVEVFGKGTFRGIG 2306
            |::..:...|...:|.|||     ..|.|||..|:.|.....|             |||   |.|
  Fly    45 WQIEDQASQPRKRRFGSSV-----YTLKEMEEATSSFSDENLL-------------GKG---GFG 88

  Fly  2307 RNYRIAKCTAAKCALRQL 2324
            |.|:....|....|::::
  Fly    89 RVYQGTLKTGEVVAIKKM 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6984NP_611187.1 crotonase-like 24..283 CDD:474030
DciNP_612065.1 CaiD 9..258 CDD:440647 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.