| Sequence 1: | NP_611186.2 | Gene: | CG30460 / 36924 | FlyBaseID: | FBgn0050460 | Length: | 1868 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_084373.1 | Gene: | 1700034E13Rik / 78414 | MGIID: | 1925664 | Length: | 108 | Species: | Mus musculus |
| Alignment Length: | 31 | Identity: | 16/31 - (51%) |
|---|---|---|---|
| Similarity: | 18/31 - (58%) | Gaps: | 1/31 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 249 TQLTPCPCCSRTFAVDTLRKHVVICE-KASK 278 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30460 | NP_611186.2 | zf-C2HC_2 | 250..274 | CDD:464037 | 11/23 (48%) |
| zf-C2HC_2 | 414..435 | CDD:464037 | |||
| 1700034E13Rik | NP_084373.1 | zf-C2HC_2 | 6..29 | CDD:464037 | |
| zf-C2HC_2 | 79..103 | CDD:464037 | 11/23 (48%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||