DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mov10 and Ct55

DIOPT Version :10

Sequence 1:NP_611185.3 Gene:Mov10 / 36922 FlyBaseID:FBgn0034187 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_083418.1 Gene:Ct55 / 75013 MGIID:1922263 Length:236 Species:Mus musculus


Alignment Length:156 Identity:34/156 - (21%)
Similarity:55/156 - (35%) Gaps:43/156 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 KRLINDRVVGQEDVGIVAPYTAQGKLVTKLLQSKGYPNVEVGSVETYQGREKTIIIASLVKSFTN 638
            ::|:.|....|...|:||...:....:||..:|..  :||.|.              :.:|:..|
Mouse    26 QKLLEDATSLQNKQGVVAGSCSNYDCMTKHTRSSA--DVETGD--------------NPLKAEPN 74

  Fly   639 MGFMC---NPRRVNVLL-----------SRAKALLI----LVGNPVTLRHHSDFKFVINECKKHG 685
            :....   :||.:|.:.           |..:.||.    |||:.....|...|...| .||...
Mouse    75 LPAAVEEQSPRGLNAVTVDNDHDEEPSESHMRILLASITSLVGDADYNGHGFSFSLDI-ACKDFK 138

  Fly   686 TY--------LLKKRDSGQRPHILIK 703
            .|        ...::|:..|..||:|
Mouse   139 PYNGDLVEIEFSDEQDTQSRRAILVK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mov10NP_611185.3 DEXXQc_Helz-like 251..499 CDD:350796
DNA2 <388..684 CDD:440729 28/127 (22%)
Ct55NP_083418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..84 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.