DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6967 and LOC100360296

DIOPT Version :9

Sequence 1:NP_611185.3 Gene:CG6967 / 36922 FlyBaseID:FBgn0034187 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_008771545.2 Gene:LOC100360296 / 100360296 RGDID:2322455 Length:239 Species:Rattus norvegicus


Alignment Length:192 Identity:35/192 - (18%)
Similarity:68/192 - (35%) Gaps:42/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 SLLLKNSNCSKSIYDHIKA--SRIVKYGIIVATLCTVARLVTDTLGRYNFFTHIFIDEAGASTEP 424
            |.....||.|:.|.:....  :|:.....:|.:||.....:.|::        :|..|..:...|
  Rat     9 STFFHGSNTSEEISEEQPQDNTRLKSIQGVVTSLCNYYGWINDSI--------LFNVEVISDNVP 65

  Fly   425 EALIG---IMGIKQTADCHVILSGDHKQLGAVIKSNRAASLG--LSRSLMERLLQSDCYKSDE-- 482
             ..||   :..::|....|.:.:...|.:..:.:.:..:.||  |....:..:.:.|.|.|::  
  Rat    66 -LKIGTNVLALVEQDEVTHTLKTIKVKVMTDLPEGSEPSKLGKRLCIRCVTSVTEEDVYISEDVS 129

  Fly   483 ------NG------------NYDRNRQMRLCRNYRSHPQIVRLFNELYY------NGELKAQ 520
                  :|            .|..|..|.....:...|...:..||:|.      ||.::|:
  Rat   130 FPLYLFSGAFKPFKGDLVLVEYSMNSGMSNINIHSVSPLSCQDINEVYVTSIDGRNGMVEAR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6967NP_611185.3 AAA_11 251..456 CDD:289831 18/98 (18%)
AAA_19 256..323 CDD:289986
UvrD_C_2 464..665 CDD:304668 15/83 (18%)
LOC100360296XP_008771545.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.