DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fat-spondin and spon2

DIOPT Version :9

Sequence 1:NP_477435.1 Gene:fat-spondin / 36919 FlyBaseID:FBgn0026721 Length:763 Species:Drosophila melanogaster
Sequence 2:XP_031757621.1 Gene:spon2 / 780015 XenbaseID:XB-GENE-945214 Length:345 Species:Xenopus tropicalis


Alignment Length:322 Identity:98/322 - (30%)
Similarity:153/322 - (47%) Gaps:45/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 CCACDEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAE 249
            |.|.:.||||.||.|.|:..:.||.||.......:|.::|.:|.|::..|.:...|:.|.|..||
 Frog    51 CTAEEIAKYSIVFTGKWTQASFPKQYPLYRPPAQWSTLLGVTHSSDYHMWKKLEPASNGVRDFAE 115

  Fly   250 WGSPAALETELRANGPKLRTLIKAAGLW-YPNVNQNT---SSKFRVDRKHPKVSLVSMFGPSPDW 310
            .|....|..|:...|.|::::   .|:: ..:::..|   |::|....:||.||.:....|||||
 Frog   116 KGEAWPLMKEIETAGEKIQSV---HGIFSTASISGGTGQASTEFEAHSRHPFVSFMVRIVPSPDW 177

  Fly   311 VVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITTMYPEDPRAPF 375
            .||:..|:|| |...||::...:|.|:|||||||.::.|||..|.|...:..||...|..|...|
 Frog   178 FVGVDTLNLC-EGKHWKQTATLELHPYDAGTDSGFTFSSPNFATIPQGIVTEITASSPSHPANSF 241

  Fly   376 YNPKSREMTPLAKLYLRREK--------IVSRNCDDEFLQALQLEVSDDAEEQDTRAECRVGDYS 432
            |.|:.:.:.|:||:...:.|        |||.      :.....|:::...|  |..:|.|..:|
 Frog   242 YYPRLKSLPPIAKVVFTKVKGRLSSFLDIVSN------VTTTGNEIAEHILE--TPLDCEVSVWS 298

  Fly   433 AWSPCSVSCG-KGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAAIPECADGPAQSKDRDDD 493
            :|..|..||| .|::.|:|......|.:...|                    ||.::|::.|
 Frog   299 SWGLCRGSCGTAGVKSRTRYIRLKPANNGTAC--------------------PALNEDKECD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fat-spondinNP_477435.1 Reeler 24..172 CDD:260081
Spond_N 191..378 CDD:283999 68/190 (36%)
TSP1 428..473 CDD:214559 12/45 (27%)
TSP1 518..566 CDD:214559
TSP1 581..627 CDD:214559
Kunitz_BPTI 643..694 CDD:278443
TSP1 714..763 CDD:214559
spon2XP_031757621.1 Spond_N 57..244 CDD:399462 68/190 (36%)
TSP1_spondin 292..344 CDD:408798 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.