DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fat-spondin and Spon2

DIOPT Version :9

Sequence 1:NP_477435.1 Gene:fat-spondin / 36919 FlyBaseID:FBgn0026721 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_612542.1 Gene:Spon2 / 171569 RGDID:708584 Length:330 Species:Rattus norvegicus


Alignment Length:288 Identity:103/288 - (35%)
Similarity:143/288 - (49%) Gaps:15/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 CCACDEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAE 249
            |.|...|:||..|.|.||....||.||.......:|.::||:|.|::|.|.:|...:.|.|..||
  Rat    34 CTARPLARYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAE 98

  Fly   250 WGSPAALETELRANGPKLRT---LIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSMFGPSPDWV 311
            .|...||..|:.|.|.||::   :..|..:  |:....||::..|..:|..||.|....|||||.
  Rat    99 RGEAWALMKEIEAAGEKLQSVHAVFSAPAV--PSGTGQTSAELEVHPRHSLVSFVVRIVPSPDWF 161

  Fly   312 VGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITTMYPEDPRAPFY 376
            |||..|||| |...|||.:..||:|.|||||||.::.|||..|.|.:.:..||...|..|...||
  Rat   162 VGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFY 225

  Fly   377 NPKSREMTPLAKLYLRREKIVSR-----NCDDEFLQALQLEVSDDAEEQDTRAECRVGDYSAWSP 436
            .|:.:.:.|:||:...|.:...|     :.|   |.:...|:.|.....:|..:|.|..:|:|..
  Rat   226 YPRLKSLPPIAKVTFVRLRQSPRAFAPPSLD---LASRGNEIVDSLSVPETPLDCEVSLWSSWGL 287

  Fly   437 CSVSCGK-GIRMRSRQYLYPAAADQNKC 463
            |...||| |.:.|:|......|.:...|
  Rat   288 CGGPCGKLGAKSRTRYVRVQPANNGTPC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fat-spondinNP_477435.1 Reeler 24..172 CDD:260081
Spond_N 191..378 CDD:283999 77/189 (41%)
TSP1 428..473 CDD:214559 12/37 (32%)
TSP1 518..566 CDD:214559
TSP1 581..627 CDD:214559
Kunitz_BPTI 643..694 CDD:278443
TSP1 714..763 CDD:214559
Spon2NP_612542.1 Spond_N 40..227 CDD:283999 77/189 (41%)
TSP1 279..329 CDD:214559 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.