DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fat-spondin and Spon2

DIOPT Version :9

Sequence 1:NP_477435.1 Gene:fat-spondin / 36919 FlyBaseID:FBgn0026721 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_598664.3 Gene:Spon2 / 100689 MGIID:1923724 Length:330 Species:Mus musculus


Alignment Length:295 Identity:102/295 - (34%)
Similarity:144/295 - (48%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 CCACDEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAE 249
            |.|...|:||..|.|.||....||.||.......:|.::||:|.|::|.|.:|...:.|.|..||
Mouse    34 CTARPLARYSITFIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAE 98

  Fly   250 WGSPAALETELRANGPKLRT---LIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSMFGPSPDWV 311
            .|...||..|:.|.|.||::   :..|..:  |:....||::..|..:|..||.|....|||||.
Mouse    99 RGEAWALMKEIEAAGEKLQSVHAVFSAPAI--PSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWF 161

  Fly   312 VGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITTMYPEDPRAPFY 376
            |||..|||| |...|||.:..||:|.|||||||.::.|||..|.|.:.:..||...|..|...||
Mouse   162 VGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFY 225

  Fly   377 NPKSREMTPLAKL-YLRREK-----------IVSRNCDDEFLQALQLEVSDDAEEQDTRAECRVG 429
            .|:.:.:.|:||: ::|.::           :.||.          .|:.|.....:|..:|.|.
Mouse   226 YPRLKSLPPIAKVTFVRLQQSPRAFAPPSLDLASRG----------NEIVDSLSVPETPLDCEVS 280

  Fly   430 DYSAWSPCSVSCGK-GIRMRSRQYLYPAAADQNKC 463
            .:|:|..|...||| |.:.|:|......|.:...|
Mouse   281 LWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fat-spondinNP_477435.1 Reeler 24..172 CDD:260081
Spond_N 191..378 CDD:283999 77/189 (41%)
TSP1 428..473 CDD:214559 12/37 (32%)
TSP1 518..566 CDD:214559
TSP1 581..627 CDD:214559
Kunitz_BPTI 643..694 CDD:278443
TSP1 714..763 CDD:214559
Spon2NP_598664.3 Spond_N 40..227 CDD:368927 77/189 (41%)
TSP1 279..329 CDD:214559 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.