DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and SET5

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_012077.1 Gene:SET5 / 856614 SGDID:S000001250 Length:526 Species:Saccharomyces cerevisiae


Alignment Length:358 Identity:77/358 - (21%)
Similarity:129/358 - (36%) Gaps:116/358 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DFARKCEIK-QNDTLGRFAVALCNVRAGETLLLEN-PIVVLP-------LMGERRCSKC----FN 58
            |...|.|:| .:|..||...|..:...|:.:|.|| |||.:|       :...:.|::|    ::
Yeast   109 DSDAKVEVKFIDDEHGRGLFAKRDFSKGQIILKENKPIVYIPPLDKLFLISNGKACARCGKALYD 173

  Fly    59 LTES-------FCRKCRLLALCEDC-----SDHD--------------------------ERDC- 84
            ||:.       .|..|:.:...|.|     |.|:                          |:.| 
Yeast   174 LTQHKIMVHYLDCEVCKAIWCSEKCKKAHASLHELLYHSWRSNRIDILHAGNWKRFVNYCEKYCF 238

  Fly    85 -------------------------KRLAEMNFSDDQVELLQKKEHTEIQPVLKCLLLREHEETL 124
                                     ::||.::    |.|.::.::.:.|......|    :..|:
Yeast   239 TAAFSVGLIYGSMLLDTTGEVKEQWQKLASIS----QRERIKLRDASGIGSTFSLL----NGTTV 295

  Fly   125 PLYEEMSQMDSQLMTRRGTE-------VWKNYQEHAFTPLDYGGVLAQLRGAADEDLVQGLLGIL 182
            ...||     |...|::|.|       ||:...|.      :.|...:.....|.:....::|..
Yeast   296 HTEEE-----SDNGTKKGVEKNIDDETVWEKCYEL------FCGAFPKASEEIDFEKFLTMIGTF 349

  Fly   183 DINAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVI-SIDDEQRIKVYANRFIAAGEILYNCYTN 246
            :||.|..:          :|.......|.|.||..| .:::.:.::::|.:.|..||.:...|.|
Yeast   350 NINQYNGQ----------VYHWISFINHDCEPNAYIEQVEEHEELRLHARKPIKKGEQIRITYVN 404

  Fly   247 VLLGTEERRKILKVGKCFDCSCPRCQDPTELGT 279
            .|.|...||:.|:|...|.|.|.|||:  ||.|
Yeast   405 PLHGVRLRRRELRVNWGFLCQCDRCQN--ELST 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 14/65 (22%)
SET5NP_012077.1 SET 41..526 CDD:225491 77/358 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.