DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and SET6

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 / 855938 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:57/243 - (23%)
Similarity:91/243 - (37%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KCFNLTESFCRKCRLLALCEDC--SDHDERDCKRLAEMNFSDDQVELLQKKEHTEIQPVLK---C 114
            |.:|.|.....|...:.:.|:.  |..||.:.|.:..:|      .:...|...::.|..:   |
Yeast   136 KRYNYTSEQEEKLNSILISENVIQSSWDEIESKWIPRIN------NMKSAKRINQLPPTCEDEYC 194

  Fly   115 LLLREHEETLPLYEEMSQMDSQLMTRR------GTEVWK--------NYQEHAFTPLDYGGVLAQ 165
            .:....|...    .:..||.|.:|.|      ..|:.|        ::|:..|..| |..:.:.
Yeast   195 CIRFVCESLF----NLKYMDPQCITYRAFNMLQSNELSKISKFPVLLHFQKLVFQTL-YILLPSH 254

  Fly   166 LRGAADEDLVQGLLGILDINAYEIRAPEVGGAMR-----GLYRRAGLFAHSCTPNLVISIDDEQR 225
            |.......|::.:||....||:.:.........|     .::..|..|.|||.|| :........
Yeast   255 LHRMLSIPLLRHILGTEYGNAFGLWQEGEASDSREYFGYWVFPEASYFNHSCNPN-ITKYRKGNS 318

  Fly   226 IKVYANRFIAAGEILYNCYTNVL-LGTEERRKILKVGKCFDCSCPRCQ 272
            :....||.|...|.:...|:.|| |.|.:||..|.....|||:|.||:
Yeast   319 MLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAFLADSWFFDCACERCK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 16/69 (23%)
SET6NP_015160.1 SET <1..370 CDD:225491 57/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.