DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and ASHR2

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_849991.1 Gene:ASHR2 / 816483 AraportID:AT2G19640 Length:398 Species:Arabidopsis thaliana


Alignment Length:316 Identity:68/316 - (21%)
Similarity:105/316 - (33%) Gaps:104/316 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GRFAVALCNVRAGETLLLENPIVV---LPLMGER---RCSKCFNLTESF----CRKCRLLALCE- 74
            ||..||..::|||:.:|.|:|:::   .|.:...   .|..||.|..|.    |:.|.|::.|. 
plant    22 GRSLVAAQSLRAGQVILRESPLLLYSAFPFLSSSVSPYCDHCFRLLASSAHQKCQSCSLVSFCSP 86

  Fly    75 DC-SDHDERDCKRLAEMN------FSDDQVELLQKKEHTEIQPVLKCLLLREHEETLPLYEEMSQ 132
            :| :.|....|:.|..::      |||              ||                      
plant    87 NCFASHTPWLCESLRRLHQSSSSAFSD--------------QP---------------------- 115

  Fly   133 MDSQLMTRRGTEVWKNYQEHAFTPLDYGGVLAQLRGAADE------------------------- 172
            .|.|:..|   .:...|...|.:|.|: .:|..|:|:...                         
plant   116 SDRQVQAR---FLLSAYNLAAASPSDF-QILLSLQGSGSSNGDPSCSAGDSAAAGFLHSLLSSVC 176

  Fly   173 ---------DLVQGLLGILDINAYEIRAP-EVGGAMR-----GLYRRAGLFAHSCTPN------L 216
                     ||...||....:||:.:..| .|....|     |:|.:...|.|.|.||      :
plant   177 PSLPVSISPDLTAALLSKDKVNAFGLMEPCSVSNEKRSVRAYGIYPKTSFFNHDCLPNACRFDYV 241

  Fly   217 VISIDDEQRIKVYANRFIAAGEILYNCYTNVLLGTEERRKILKVGKCFDCSCPRCQ 272
            ..:.|....|.:.....:..|..:...|..|.:....|:|.|.....|.|.|.||:
plant   242 DSASDGNTDIIIRMIHDVPEGREVCLSYFPVNMNYSSRQKRLLEDYGFKCDCDRCK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 16/76 (21%)
ASHR2NP_849991.1 SET <192..275 CDD:214614 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.