DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and Smyd3

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001020933.1 Gene:Smyd3 / 498295 RGDID:1562635 Length:428 Species:Rattus norvegicus


Alignment Length:471 Identity:109/471 - (23%)
Similarity:187/471 - (39%) Gaps:104/471 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ALCNVRAGETLLLENPIVVLPLMGERR--CSKCFNLTESF--CRKCRLLALCE-DCS-----DHD 80
            |:..:|.||.|...:|:......|.|.  |.:|....|..  |.:||:...|. .|.     || 
  Rat    20 AVAPLRPGELLFRSDPLAYTVSKGSRGVVCDRCLLGKEKLMRCSQCRIAKYCSAKCQKKAWPDH- 83

  Fly    81 ERDCKRL--AEMNFSDDQVELLQKKEHTEIQPVLKCLLLREHEETLPLYEEMSQMDSQLMTRRGT 143
            :|:||.|  .:..:..|.|.||.:        |:..|:..:..|:..||   |..|.:....:.|
  Rat    84 KRECKCLKSCKPRYPPDSVRLLGR--------VVVKLMDGKPSESEKLY---SFYDLESNISKLT 137

  Fly   144 EVWK-NYQEHAFTPLDYGGVLAQLRGAA----DEDLVQGLLGILDINAYEIRAPEVGGAMRGLYR 203
            |..| ..::.|.|...:  :..:::.|:    ..||.:....:: .|::.|...|:.....|||.
  Rat   138 EDKKEGLRQLAMTFQHF--MREEIQDASQLPPSFDLFEAFAKVI-CNSFTICNAEMQEVGVGLYP 199

  Fly   204 RAGLFAHSCTPNLVISIDDEQRIKVYANRFIAAGEILYNCYTNVLLGTEERRKILKVGKCFDCSC 268
            ...|..|||.||..| :.:...:.:.|.|.|.|||.|..||.::|:.:|||||.|:...||:|.|
  Rat   200 SMSLLNHSCDPNCSI-VFNGPHLLLRAVREIEAGEELTICYLDMLMTSEERRKQLRDQYCFECDC 263

  Fly   269 PRCQDPTELGTHMSSFICSQCSCVDGYIVRQPDTGIWQCLLNPEHTLKQEFVSNMLERAKEEIFH 333
            .|||...:....::.                 |..||            :.|...|::.:|...|
  Rat   264 IRCQTQDKDADMLTG-----------------DEQIW------------KEVQESLKKIEELKAH 299

  Fly   334 ARDDIYRQELLLAKLSRLLHRNHFLMLDLKQNIASILRQILQ-------NMGTRPNKKVYERKIR 391
                 ::.|.:||....:::.|...:.|:  ||..:  ::|.       |:|      :.|..:.
  Rat   300 -----WKWEQVLALCQAIINSNSERLPDI--NIYQL--KVLDCAMDACINLG------MLEEALF 349

  Fly   392 LCQEILLVLKVVTPGISRLKAIALYELANTQAELARKMYTE-----------------MEHS-AN 438
            .....:...::..||...::.:.:.::...|  |.:.|:.:                 .||| ..
  Rat   350 YAMRTMEPYRIFFPGSHPVRGVQVMKVGKLQ--LHQGMFPQAMKNLRLAFDIMKVTHGREHSLIE 412

  Fly   439 DLLAELERVEVMLRES 454
            ||:..||..:..:|.|
  Rat   413 DLILLLEECDANIRAS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 20/64 (31%)
Smyd3NP_001020933.1 zf-MYND 49..87 CDD:280009 11/38 (29%)
SET <201..239 CDD:279228 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.