DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and Smyd4-4

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster


Alignment Length:360 Identity:82/360 - (22%)
Similarity:120/360 - (33%) Gaps:103/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FARKC-EIKQNDTLGRFAVALCNVRAGETLLLENPI--VVLPLMGERRCSKCFN---LTESFCRK 66
            |...| |:::....|||.|...::..|:.:.:|.|.  .:|..|...||:.|..   ||...|..
  Fly   182 FIADCLELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRENYLTLIPCDS 246

  Fly    67 CRLLALCEDCSDHDERDCKRLAEMNFSD------DQVELLQKKEHTEIQPVLKCLLLREHEETL- 124
            |.....|.:       :||.:|...:..      |.:..:..|.|        |:.||.....| 
  Fly   247 CCSTMFCSE-------ECKSIAMQTYHRYECPIIDFLNRMFNKIH--------CIALRTTLVALN 296

  Fly   125 --PLYEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLD-----YGGVLAQ-LRGAAD---------- 171
              |..||:.....|...:.......||.|  .||.:     :|.|..| ||..:|          
  Fly   297 IFPSIEELIDFCEQEQNQDKCAFDLNYNE--LTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCAV 359

  Fly   172 ------------------------EDLVQGLLGILDINAYEIRAPEVGGAMR-------GLYRRA 205
                                    .||:...|.....|.:.|...|.....:       |.|...
  Fly   360 LKHFIIEYTPVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGAYAFL 424

  Fly   206 GLFAHSCTPNLVISIDDEQRIKVYANRFIAAGEILYNCYTN--VLLGTEERRKILKVGKCFDCSC 268
            .|..|||.|| .:.|.:..:..::..|.|.||.:||:.|..  .:...|:|.|.|.:...|||.|
  Fly   425 SLINHSCAPN-TVRIYEGTKAYMFVLRPIKAGNVLYDNYGAHFAICSKEQRLKRLSLQYRFDCKC 488

  Fly   269 PRCQ-------------------DPTELGTHMSSF 284
            ..|:                   |.|||.  :||:
  Fly   489 EGCELNYPMFGMMPHKATVPSVTDDTELA--LSSY 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 19/71 (27%)
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 10/46 (22%)
SET 363..463 CDD:279228 21/100 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.