DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and Smyd5

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:388 Identity:82/388 - (21%)
Similarity:124/388 - (31%) Gaps:133/388 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GRFAVALCNVRAGETLLLENPIVVLPLMGE-----RRCSKCFNLTE------------------- 61
            |.||..|  :|.|||:.:|.|:|....:..     |.|..|....|                   
  Rat    35 GLFATQL--IRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPH 97

  Fly    62 -------------------SFC-RKCRLLA-------LCEDCSDHDER-DCKRLAE----MNFSD 94
                               ::| .:|||.|       ||...|..|.| ...:|.|    :::..
  Rat    98 PELCSVRKDLHQNCPRCQVTYCSAECRLAAAEQYHQILCPGPSQDDPRHPLNKLQEAWRSVHYPP 162

  Fly    95 DQVELL------------QKKEHTEIQPVLKCLLLREHEETL--PLYEEMSQMDSQLMTRRGTEV 145
            :...::            :.|:|........|......||.:  .|..:..:...:|:.|..||.
  Rat   163 ETASIMLMARMVATVKQAKDKDHWVRLFSHFCSKTANEEEEIVHKLLGDKFKGQLELLRRLFTEA 227

  Fly   146 WKNYQE---HAFTPLDYGGVLAQL----RGAADEDLVQGLLGILDINAYEIRAPE---VGGAMRG 200
            .  |:|   ..|||..:..:.|.:    :|.....|.|   .:...:|.|::..|   :...:..
  Rat   228 L--YEETLSQWFTPDGFRSLFALVGTNGQGIGTSSLSQ---WVHACDALELKPQEREQLDTFIDQ 287

  Fly   201 LYR-------------RAGLFA------HSCTPNLVISIDDEQ-RIKVYANRFIAAGEILYNCYT 245
            ||:             .:|||.      |||.||...|..:.. .:.|.|...|..||.:...|.
  Rat   288 LYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIEPGEEICISYL 352

  Fly   246 NVL---LGTEERRKILKVGKCFDCSCPRC----QDP-------------------TELGTHMS 282
            :..   .....|.|||:....|.||||:|    .||                   .|||..|:
  Rat   353 DCCQRERSRHSRHKILRENYLFVCSCPKCLAEADDPNVTSEEEEEEDEEEGEPEDAELGDEMT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 19/87 (22%)
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 12/75 (16%)
SET <298..351 CDD:214614 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.