DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and Zmynd15

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:363 Identity:73/363 - (20%)
Similarity:107/363 - (29%) Gaps:168/363 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DQVELLQKKEHTEIQPVLKCLLLREHEETLPLYEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLDY 159
            ::.|..:::||.|.:|..:.:.|:|..|..|..:|:.|           || |..||...|    
  Rat   116 EEEEEEEEEEHGEERPGTEKVELQEGGEPAPPSKELPQ-----------EV-KPAQESEVT---- 164

  Fly   160 GGVLAQLRGAADEDLVQGLLGILDINAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISIDDEQ 224
                 |...:.||       |..:..|.:.||||         :|.|                  
  Rat   165 -----QQEASCDE-------GCREERAEDERAPE---------KRKG------------------ 190

  Fly   225 RIKVYANRFIAAGEILYNCYTNVLLGTEERRKIL-----------KVGK---------------C 263
                   |...|..:..:|   :||.|:|...||           .||:               |
  Rat   191 -------RKTEAAPLHLSC---LLLVTDEHGTILGIDLLMDGAQGSVGQSPGTENLAPRAYALLC 245

  Fly   264 FDCSCPR-CQDPTE---------------------LGT--------------------------- 279
            ...:||. ..||.:                     ||.                           
  Rat   246 HSMACPMGSGDPRKPRQLTVGDAHLHRELESLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCH 310

  Fly   280 --HMSSF-----ICSQCSCV--DGYIVRQPDTGIW-QCLLNPEHTLKQEFVSNMLERAKE----- 329
              |..||     .|.|||.|  .|....|.|   | :|..:..|......::..:|||.|     
  Rat   311 VCHKHSFEVKLTPCPQCSAVLYCGEACLQAD---WRRCPDDVSHRFWCPRLAAFMERAGELASLP 372

  Fly   330 -----EIFHARDDIYRQELLLAKLSRLLHRNHFLMLDL 362
                 |:   ..:.:.:|..||  ||.|.|.::..|.:
  Rat   373 FTYTAEV---TSETFNKEAFLA--SRGLTRGYWTQLSM 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 10/64 (16%)
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:280009 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.