DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and ERLIN1

DIOPT Version :10

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_006450.2 Gene:ERLIN1 / 10613 HGNCID:16947 Length:348 Species:Homo sapiens


Alignment Length:174 Identity:42/174 - (24%)
Similarity:67/174 - (38%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 HTLKQEFVSNMLERAKEEIFHARDDIYRQEL-----LLA-------------KLSRLLHRNHFLM 359
            |.|.|...::.|:....|:|...|:..:|.|     |:|             |:...:.||..||
Human   124 HELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELM 188

  Fly   360 LDLKQN--IASILRQILQNMG-TRPNKKVYE-------RKIRLCQEILLVLKVVTPGISRLK--A 412
            ...|..  ||:..:::::... |...|.|.|       .|||..|:::  .|.....||.::  |
Human   189 EAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVM--EKETEKRISEIEDAA 251

  Fly   413 IALYELANTQAE--LARKMYTEMEHSANDLLAELERVEVMLRES 454
            ....|.|...||  .|.|..|..:|.......||::.:.:...|
Human   252 FLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKKYQAIASNS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET_SMYD <185..271 CDD:380997
ERLIN1NP_006450.2 SPFH_like_u3 23..310 CDD:259804 42/174 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..348
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.