DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and SMYD5

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_006053.2 Gene:SMYD5 / 10322 HGNCID:16258 Length:418 Species:Homo sapiens


Alignment Length:359 Identity:71/359 - (19%)
Similarity:109/359 - (30%) Gaps:120/359 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GRFAVALCNVRAGETLLLENPIVVLPLMGE-----RRCSKCFNLTESF----------------- 63
            |.||..|  :|.|||:.:|.|:|....:..     |.|..|....|..                 
Human    35 GLFATQL--IRKGETIFVERPLVAAQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPH 97

  Fly    64 -------------CRKCRLLALCEDCSDHDERDCKRLAEMNF---------SDDQVELLQKKEHT 106
                         |..|:::.    ||    .:|:..|...:         .||.:..|.|.:..
Human    98 PELCTVRKDLHQNCPHCQVMY----CS----AECRLAATEQYHQVLCPGPSQDDPLHPLNKLQEA 154

  Fly   107 ----EIQPVLKCLLL-----------------------------REHEETL-PLYEEMSQMDSQL 137
                ...|....::|                             .|.||.: .|..:..:...:|
Human   155 WRSIHYPPETASIMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQLEL 219

  Fly   138 MTRRGTEVWKNYQEHA---FTPLDYGGVLAQL----RGAADEDLVQGLLGILDINAYEIRAPEVG 195
            :.|..||..  |:|..   |||..:..:.|.:    :|.....|.|.:.....:........::.
Human   220 LRRLFTEAL--YEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQLD 282

  Fly   196 GAMRGLYR-------------RAGLFA------HSCTPNLVISIDDEQ-RIKVYANRFIAAGEIL 240
            ..:..||:             .:|||.      |||.||...|..:.. .:.|.|...|..||.:
Human   283 AFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEI 347

  Fly   241 YNCYTNVL---LGTEERRKILKVGKCFDCSCPRC 271
            ...|.:..   .....|.|||:....|.||||:|
Human   348 CISYLDCCQRERSRHSRHKILRENYLFVCSCPKC 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 16/84 (19%)
SMYD5NP_006053.2 SET <298..351 CDD:214614 14/52 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.