DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and smyd3

DIOPT Version :9

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_031758360.1 Gene:smyd3 / 100494527 XenbaseID:XB-GENE-854970 Length:448 Species:Xenopus tropicalis


Alignment Length:528 Identity:105/528 - (19%)
Similarity:191/528 - (36%) Gaps:142/528 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAVTDDFARKCEIKQNDTLGRFAVALCNVRAGETLLLENPIVVLPLMGERRCSKCFNLTESF-- 63
            |:.:.:.|       |:...|....||.::..|.|:::..|.|......:..|..|.:..|..  
 Frog    22 MSGILEKF-------QSPGKGNGVRALKDMSHGLTVMIAEPYVYTVCRIKTACDHCLHRKEKLLR 79

  Fly    64 CRKCRLLALCED-CS----DHDERDCKRLAEM--NFSDDQVELLQKKEHTEIQPVLKCLLLREHE 121
            |.:|::...|.. |.    ...:|:||.|...  |...:.|.|:.|        ::..:|.:...
 Frog    80 CSQCKVARYCNSHCQRKAWQGHKRECKCLRSTLPNVPPNSVRLVGK--------IIFKMLQKPDT 136

  Fly   122 ETLPLYEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLD----------------------YGGVLA 164
            .:..|| .:|.:.|.:  :..:|..|:...|..|.|.                      :|.|.|
 Frog   137 ASEELY-TISDLQSHI--KEASEEVKDGLRHLATALQHYLKEEIQEISQLPPGFQVLEYFGKVSA 198

  Fly   165 QLRGAADEDLVQGLLGILDINAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISIDDEQRIKVY 229
            :                :..|::.|...|:.....|||....|..|||.||.|| :.:...:.:.
 Frog   199 K----------------VTCNSFTISDGEMQDVGVGLYPSMSLLNHSCDPNCVI-VFEGTCLLLR 246

  Fly   230 ANRFIAAGEILYNCYTNVLLGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDG 294
            ..:.|..||.|...|.:|.:.|:.||..|:...||.|.|.||                       
 Frog   247 TVKEIPKGEELTISYIDVKMPTQGRRDQLQRQYCFLCDCQRC----------------------- 288

  Fly   295 YIVRQPDTGIWQCLLNPEHTLKQEFVSNMLERAKEEIFHARDDIYRQELLLAKLSRLLHRNHFLM 359
             ::|..|               ::.::...|.::|           .|..:::|..||.:|    
 Frog   289 -LLRDKD---------------EDMLAGDAEASRE-----------VESSVSRLEELLSQN---- 322

  Fly   360 LDLKQNIASILRQILQNMGTRPNKKVYERKIRLCQ-----EILLVLKVVTPGISRLKAIALYELA 419
               ....|..|.:.|.|....|:|.:|:.||..|.     ::.|..:.:..|:..|:..:|| .:
 Frog   323 ---TAEEALNLCKTLMNRYYLPDKNIYQLKILDCAMDASIDLGLWEEALHFGLRTLEPYSLY-YS 383

  Fly   420 NTQAELARKMYTEMEHSANDLLAELERVEVMLRESLRML--LFEPLATPEGQLTRSMLRELKELQ 482
            |.....|.::..         :.:|:..:.:..|:::.|  .|:.:....|: .....::|.||.
 Frog   384 NYHPVRAVQLMK---------VGKLQNYQGLFAEAMKTLKQAFDIMKVTHGR-DHGQTQQLAELM 438

  Fly   483 DDIK-NLR 489
            :|.: |:|
 Frog   439 NDCEANMR 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 18/64 (28%)
smyd3XP_031758360.1 SET_SMYD3 24..289 CDD:380980 67/323 (21%)
zf-MYND 67..105 CDD:396356 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.