Sequence 1: | NP_001261039.1 | Gene: | SmydA-7 / 36916 | FlyBaseID: | FBgn0034182 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254751.1 | Gene: | ZMYND15 / 84225 | HGNCID: | 20997 | Length: | 750 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 65/206 - (31%) | Gaps: | 71/206 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 EGMWQEHEELVVRPLMESGLADVLPTQELTSDALHAHCIRIDSNSF-------------EVTAKD 191
Fly 192 GDTLKGIFVWGATLPHHCVPNTVVALDEQFNMKLYAAVPLQPGDIIYNSYTNPLMGTSQRQHQL- 255
Fly 256 ----RLSRRLECICSRC---LDPTEM-------GTHMSSLKCKECPGFSVCEIDS-NGKLGDWRC 305
Fly 306 PDCRALLTAAE 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SmydA-7 | NP_001261039.1 | None | |||
ZMYND15 | NP_001254751.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 109..199 | 6/29 (21%) | |
zf-MYND | 313..359 | CDD:280009 | 12/32 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 565..590 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 709..750 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |