| Sequence 1: | NP_001261039.1 | Gene: | SmydA-7 / 36916 | FlyBaseID: | FBgn0034182 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001025100.1 | Gene: | Zmynd15 / 574428 | MGIID: | 3603821 | Length: | 736 | Species: | Mus musculus |
| Alignment Length: | 321 | Identity: | 71/321 - (22%) |
|---|---|---|---|
| Similarity: | 100/321 - (31%) | Gaps: | 124/321 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 121 GDCQMLIDVP-------------INLSDYRDGEGMWQEHEELVVRPLMES--------------- 157
Fly 158 --GLADVLPTQELTSD-------------------------------ALHAHCIRIDSNSFEVTA 189
Fly 190 KDGDTLKGI--FVWGATLPHHCVPNTVVALDEQFNMKLYAAVPLQPGDIIYNSYTNPL-MGTSQR 251
Fly 252 QHQL-----RLSRRLECICSRC---LDPTEM-------GTHMSSLKCKECPGFSVCEIDS-NGKL 300
Fly 301 GDWRCPDCRALLTAAEV--------------HELQAAVGSALVDAMGDLQ----VYEALLT 343 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SmydA-7 | NP_001261039.1 | None | |||
| Zmynd15 | NP_001025100.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 70..94 | 3/9 (33%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 109..192 | 15/83 (18%) | |||
| zf-MYND | 307..353 | CDD:280009 | 13/50 (26%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 556..583 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 696..736 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG2084 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||