DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-7 and Smyd5

DIOPT Version :9

Sequence 1:NP_001261039.1 Gene:SmydA-7 / 36916 FlyBaseID:FBgn0034182 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:368 Identity:72/368 - (19%)
Similarity:114/368 - (30%) Gaps:125/368 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GRHLVASIAIEPGDTILEERPLLVAPH-WEC--HQLKCAQCL----------------------- 55
            |:.|.|:..|..|:||..||||:.:.. |..  ....|..||                       
  Rat    33 GKGLFATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPH 97

  Fly    56 -------QESYVICRRCQVFPLCMDC-----NQHDEFECEFFTSGAGKALCKDILVKNFGICGLL 108
                   ::.:..|.||||.....:|     .|:.:..|    .|..:...:..|.|      |.
  Rat    98 PELCSVRKDLHQNCPRCQVTYCSAECRLAAAEQYHQILC----PGPSQDDPRHPLNK------LQ 152

  Fly   109 KLLLLLENPRTKGDCQMLIDVPINLSDYRDGEGMW------------QEHEELV----------- 150
            :....:..|.......::..:...:...:| :..|            .|.||:|           
  Rat   153 EAWRSVHYPPETASIMLMARMVATVKQAKD-KDHWVRLFSHFCSKTANEEEEIVHKLLGDKFKGQ 216

  Fly   151 ---VRPLMESGLADVLPTQELTSDA-----------------------LHAHC------------ 177
               :|.|....|.:...:|..|.|.                       :|| |            
  Rat   217 LELLRRLFTEALYEETLSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHA-CDALELKPQEREQ 280

  Fly   178 --IRIDSNSFEVTAKDGDTL----KGIFVWGATLPHHCVPNTVVALDE-QFNMKLYAAVPLQPGD 235
              ..||....::.|..|:.|    .|:||..:...|.||||...:..| .|.:.:.|...::||:
  Rat   281 LDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIEPGE 345

  Fly   236 IIYNSYTNPLMGTSQRQHQLRLSRR---LECICSRCL----DP 271
            .|..||.:.......|..:.::.|.   ..|.|.:||    ||
  Rat   346 EICISYLDCCQRERSRHSRHKILRENYLFVCSCPKCLAEADDP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-7NP_001261039.1 None
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 12/79 (15%)
SET <298..351 CDD:214614 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337011
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.