DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-7 and Zmynd15

DIOPT Version :9

Sequence 1:NP_001261039.1 Gene:SmydA-7 / 36916 FlyBaseID:FBgn0034182 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:268 Identity:64/268 - (23%)
Similarity:89/268 - (33%) Gaps:88/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GDCQMLIDVP-------------INLSDYRDGEGMWQEHEEL--VVRP------LMESG------ 158
            |..::|.|.|             ::|.|..:||...:|.||.  ..||      |.|.|      
  Rat    84 GASRLLGDEPPLHLRDLSPYVSFVSLEDGEEGEEEEEEEEEEHGEERPGTEKVELQEGGEPAPPS 148

  Fly   159 ---LADVLPTQELTSDALHAHCIRIDSNSFEVTAKD---GDTLKGIFVWGATLPHHCV------P 211
               ..:|.|.||.......|.|   |....|..|:|   .:..||.....|.|...|:      .
  Rat   149 KELPQEVKPAQESEVTQQEASC---DEGCREERAEDERAPEKRKGRKTEAAPLHLSCLLLVTDEH 210

  Fly   212 NTVVALD----------------EQFNMKLYAAVPLQPGDIIYNSYTNPL-MGTSQRQHQL---- 255
            .|::.:|                |....:.||        ::.:|...|: .|..::..||    
  Rat   211 GTILGIDLLMDGAQGSVGQSPGTENLAPRAYA--------LLCHSMACPMGSGDPRKPRQLTVGD 267

  Fly   256 -RLSRRLECICSRC---LDPTEM-------GTHMSSLKCKECPGFSVCEIDS-NGKLGDWRCPDC 308
             .|.|.||.:..|.   |..|.|       |...:||:.:.|   .||...| ..||..  ||.|
  Rat   268 AHLHRELESLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTC---HVCHKHSFEVKLTP--CPQC 327

  Fly   309 RALLTAAE 316
            .|:|...|
  Rat   328 SAVLYCGE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-7NP_001261039.1 None
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:280009 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.