DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF2 and CHN1

DIOPT Version :9

Sequence 1:NP_477317.1 Gene:RhoGEF2 / 36915 FlyBaseID:FBgn0023172 Length:2559 Species:Drosophila melanogaster
Sequence 2:NP_001358443.1 Gene:CHN1 / 1123 HGNCID:1943 Length:476 Species:Homo sapiens


Alignment Length:352 Identity:82/352 - (23%)
Similarity:123/352 - (34%) Gaps:129/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   976 WAYEIHSTF-----------LVPRAPLSWYRQDESLAREVDNVLQLEYDKVEILR---------T 1020
            |:..:.|.|           |:|:.|    |....::||..:.|.:..:...::|         |
Human    40 WSAMVRSRFTITSTSRVQAILLPQPP----RFHGMISREAADQLLIVAEGSYLIRESQRQPGTYT 100

  Fly  1021 VFLRSRKRAKDLISEQLREFQ----------QKR--------TAGLGTIYGPTDDKLAE--AK-- 1063
            :.||        ...|.|.|:          :||        |.||.|:|  .:.|.||  ||  
Human   101 LALR--------FGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLY--IETKAAEYIAKMT 155

  Fly  1064 ----------TDKLREQIIDKYLMPNLHALIEDENGSPPEDVRKVALCSALSTVIYRIFNTRPPP 1118
                      |...||....|: ||.|....::.:.:..:.|.:..|.|.:.....: .|.:.|.
Human   156 INPIYEHVGYTTLNREPAYKKH-MPVLKETHDERDSTGQDGVSEKRLTSLVRRATLK-ENEQIPK 218

  Fly  1119 SSIVERVHHFVSRDKSFKSRIMGKNRKMNVRGHPLVLRQYYEVTH-CNHCQTIIWGVSPQGYHCT 1182
               .|::|:|               :....||           .| |.:|...:||:..||..|.
Human   219 ---YEKIHNF---------------KVHTFRG-----------PHWCEYCANFMWGLIAQGVKCA 254

  Fly  1183 DCKLNIHRQCSKVVDESCPGPLPQAKRL----------AHNDKISKFMGKIRPRTSDVIGNEKRS 1237
            ||.||:|:||||:|...|...|...|::          ||..|        ||...|:...|..|
Human   255 DCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK--------RPMVVDMCIREIES 311

  Fly  1238 R--QDEEL-----------DVELTPDR 1251
            |  ..|.|           ||::..||
Human   312 RGLNSEGLYRVSGFSDLIEDVKMAFDR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF2NP_477317.1 PDZ 260..334 CDD:214570
RGS_GEF_like 934..1055 CDD:188710 24/116 (21%)
C1_1 1151..1202 CDD:278556 19/51 (37%)
RhoGEF 1539..1731 CDD:238091
PH_RhoGEF 1770..1875 CDD:275411
DUF2413 2242..>2378 CDD:287302
CHN1NP_001358443.1 SH2 67..145 CDD:387587 17/87 (20%)
C1_1 223..272 CDD:365894 22/74 (30%)
RhoGAP_chimaerin 283..476 CDD:239837 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.