DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and eif4g3b

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_021325628.1 Gene:eif4g3b / 568761 ZFINID:ZDB-GENE-090312-49 Length:1733 Species:Danio rerio


Alignment Length:288 Identity:64/288 - (22%)
Similarity:120/288 - (41%) Gaps:70/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SSSNSSQPDM----------ATIALEYLDTVIHCLNQ-NPGQFDSIASRF--LTIFDGMENNQFV 307
            ::.|:.:|.|          |....|....|...||: .|..|..:..:.  ||| |..|..:.|
Zfish   876 TTENAWKPGMKREGAVEDPDAQRTQELFRKVRSILNKLTPQMFSQLMKQVTDLTI-DTEERLKGV 939

  Fly   308 LSIAMEDIFEKSIEQPNFRY----MGAKLYNLLHMLNSKPDSL--FHTLL--KCKLDYHQE---- 360
            :.:    :|||:|.:|:|..    |.:.|..|...:..||:|.  |..||  :|:.::.::    
Zfish   940 IDL----VFEKAINEPSFSVAYGNMCSCLATLKVPMTDKPNSTVNFRKLLLNRCQKEFEKDKMDD 1000

  Fly   361 --------EVTKYMRSNEQQKVRE---------------TALFLAELYMQLRGDDDSRIQLIAVN 402
                    |:.....|:|:::::|               ...|:.||:         :::::...
Zfish  1001 DAFEKKHRELEAATASSERERLQEELEEAKDKARRRSIGNIKFIGELF---------KLRMLTEA 1056

  Fly   403 IVYS-LSKLLASESNENVRCLCQTLKLAGYDLTADCPKD-IQEIITALQAI--ELKSPGKYP-MA 462
            |::. :.|||.:...|::.|||:.|...|.||..:..|. :.:....::.|  |.|:..:.. |.
Zfish  1057 IMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFML 1121

  Fly   463 ASVIALQQNNWGRKVSNALGDDEDTVKE 490
            ..||.|:.:||   ||........|:::
Zfish  1122 QDVIDLRLHNW---VSRRADQGPKTIEQ 1146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 55/244 (23%)
eif4g3bXP_021325628.1 Atrophin-1 <59..632 CDD:331285
MIF4G 903..1131 CDD:280935 54/241 (22%)
MA3 1371..1482 CDD:280933
W2_eIF4G1_like 1569..1704 CDD:211397
W2 <1683..1729 CDD:327369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.