DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and eif4g2b

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001013461.2 Gene:eif4g2b / 334618 ZFINID:ZDB-GENE-030131-6550 Length:898 Species:Danio rerio


Alignment Length:358 Identity:74/358 - (20%)
Similarity:136/358 - (37%) Gaps:107/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PSTSTAAASSSSSNSSQPDMATIALEYLDTVIH----CLNQ-NPGQFDSIASRFLTIFDGMENNQ 305
            ||.||....:||:..          |:.|.:..    .||: .|.:||.:....|.:  |:: ::
Zfish    52 PSRSTRRDVNSSTEK----------EHHDAIFRKVRGILNKLTPEKFDKLCLELLNV--GVD-SK 103

  Fly   306 FVLSIAMEDIFEKSIEQPNFRYMGAKLYNLLHMLNSKPD---------------SLFHTLLKCKL 355
            .||...:..|.:|::|:|.:..:.|:|  .|.:....|:               :.|..||..||
Zfish   104 LVLKGIILLIVDKALEEPKYSSLYAQL--CLRLAEDAPNFDGPTPEIQSSQKQSTTFRRLLITKL 166

  Fly   356 DYHQEEVTKYM---------RSNEQQKVRETA--------LFLAELYMQLRGDDDSRIQLIAVNI 403
            ....|..||.:         .::|:::.|..|        .|:.||         .::.||..:|
Zfish   167 QDEFENRTKNVDLYDKQDNPLTSEEEEQRAIAKIKMLGNIKFIGEL---------GKLDLIHESI 222

  Fly   404 VYSLSKLL--------ASESNENVRCLCQTLKLAGYDLTADCPKDI-QEIITALQAI----ELKS 455
            ::...|.|        ..:..|::.||||.::..|..|..:..|.: .:....:|::    :|.:
Zfish   223 LHKCIKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLDHEKAKSLMDQYFGRMQSLMNNKDLPA 287

  Fly   456 PGKYPMAASVIALQQNNW---------GRKVSNALGDDEDTVKEPPRLSDEPVFYGPDGRELTAE 511
            ..:: :....:.|::|||         |.|..|.:  .:|.||      |..||..|..:.:.. 
Zfish   288 RIRF-LLQDTVELRENNWVPRKAFIDNGPKTINQI--RQDAVK------DLGVFIPPMNQGMRM- 342

  Fly   512 ETDFLAGGDNDGDDDFDGDGADLEIDAEMDEET 544
                          ||..:|..:....::|.||
Zfish   343 --------------DFFLEGPFMPNRMKLDRET 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 49/251 (20%)
eif4g2bNP_001013461.2 MIF4G 73..303 CDD:280935 47/244 (19%)
MA3 536..649 CDD:214714
W2_eIF4G1_like 732..867 CDD:211397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.