DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and eif4g2a

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001014311.1 Gene:eif4g2a / 323453 ZFINID:ZDB-GENE-030131-2173 Length:891 Species:Danio rerio


Alignment Length:325 Identity:69/325 - (21%)
Similarity:127/325 - (39%) Gaps:87/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PSTSTAAASSSSSNSSQPDMATIALEYLDTVIHCLNQ-NPGQFDSIASRFLTIFDGMENNQFVLS 309
            ||.||....:||:...:.|      .....|...||: .|.:||.:....|.:  |:: ::.||.
Zfish    52 PSRSTRRDVNSSNEKERHD------AIFRKVRGILNKLTPEKFDKLCLELLNV--GVD-SKLVLK 107

  Fly   310 IAMEDIFEKSIEQPNFRYMGAKLYNLLHMLNSKPD---------------SLFHTLLKCKLDYHQ 359
            ..:..|.:|::|:|.:..:.|:|  .|.:....|:               :.|..||..||....
Zfish   108 GIILLIVDKALEEPKYSSLYAQL--CLRLAEDAPNFDGPSTEIQSSQKQSTTFRRLLISKLQDEF 170

  Fly   360 EEVTKYM---------RSNEQQKVRETA--------LFLAELYMQLRGDDDSRIQLIAVNIVYSL 407
            |..|:.:         .::|:::.|..|        .|:.||         .::.||..:|::..
Zfish   171 ENRTRNVDIYDKNDSPLTSEEEEQRAIAKIKMLGNIKFIGEL---------GKLDLIHESILHKC 226

  Fly   408 SKLL--------ASESNENVRCLCQTLKLAGYDLTADCPKDIQE-----IITALQAIELKSPGKY 459
            .|.|        ..:..|::.||||.::..|..|..:..|.:.:     :.:.:...:|.:..::
Zfish   227 IKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLDHEKAKSLMDQYFGRMRSLMNNKDLPARIRF 291

  Fly   460 PMAASVIALQQNNW---------GRKVSNALGDDEDTVKEPPRLSDEPVFYGPDGRELTAEETDF 515
             :....:.|::|||         |.|..|.:  .:|.||      |..||..|..:.:   .|||
Zfish   292 -LLQDTVELRENNWVPRKAFIDNGPKTINQI--RQDAVK------DLGVFIPPMTQGI---RTDF 344

  Fly   516  515
            Zfish   345  344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 46/247 (19%)
eif4g2aNP_001014311.1 MIF4G 73..303 CDD:280935 46/244 (19%)
Med25_SD1 376..523 CDD:288132
MA3 529..642 CDD:214714
W2_eIF4G1_like 713..860 CDD:211397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.