DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and Eif4g3

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_038965571.1 Gene:Eif4g3 / 298573 RGDID:1311370 Length:1807 Species:Rattus norvegicus


Alignment Length:469 Identity:91/469 - (19%)
Similarity:145/469 - (30%) Gaps:195/469 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SSSSNSSQPDMATI-ALEYLDTVIHCLNQ-NPGQFDSIASRF--LTIFDGMENNQFVLSIAMEDI 315
            |...:|...|..:| ..|....|...||: .|..|:.:..:.  ||: |..|..:.|:.:    :
  Rat   950 SQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTV-DTEERLKGVIDL----V 1009

  Fly   316 FEKSIEQPNFRYMGAKLYNLLHMLN----SKPDSL--FHTLL--KCKLDYHQ------------- 359
            |||:|::|:|....|.:...|..|.    .||.:.  |..||  :|:.::.:             
  Rat  1010 FEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQK 1074

  Fly   360 --------EEVTKYMRSNEQ--QKVRETAL----FLAELYMQLRGDDDSRIQLIAVNIVYS-LSK 409
                    ||.|:.....|:  .|.|..::    |:.||:         :::::...|::. :.|
  Rat  1075 ELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELF---------KLKMLTEAIMHDCVVK 1130

  Fly   410 LLASESNENVRCLCQTLKLAGYDLTAD-------------------------------------- 436
            ||.:...|::.|||:.|...|.||..:                                      
  Rat  1131 LLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRL 1195

  Fly   437 C----------PKDIQEI--------------ITALQAIELKSPG-------------------- 457
            |          ||.|::|              :..|...|.:.||                    
  Rat  1196 CNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRV 1260

  Fly   458 ----KY-----PMAASVIAL----QQNNWGRKVS-NALGDDEDTVK------------EPPRLSD 496
                |:     |.....|.|    |..:||:..| .|...:.|.::            :||..|.
  Rat  1261 LDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRSSASSLNRFSPLQPPAPSG 1325

  Fly   497 EP-------------VFYGPDGREL--------TAEETDFLAGGDNDGDDDFDGDGADLEIDAEM 540
            .|             ...|..|||.        ||....||.|...|            .:|.:.
  Rat  1326 SPSATPLDFDSRRALTSRGSMGREKSDKPLPAGTARPNTFLRGSSKD------------LLDNQS 1378

  Fly   541 DEETERAYKEFCKQ 554
            .||..|...|..||
  Rat  1379 QEEQRREMLETVKQ 1392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 61/335 (18%)
Eif4g3XP_038965571.1 PHA03247 <65..498 CDD:223021
MIF4G 969..1197 CDD:397130 46/241 (19%)
MA3 1435..1547 CDD:397128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.