DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and Eif4g1

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_006248643.1 Gene:Eif4g1 / 287986 RGDID:1306144 Length:1599 Species:Rattus norvegicus


Alignment Length:343 Identity:70/343 - (20%)
Similarity:124/343 - (36%) Gaps:103/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 QPSTSTAAASSSSSNSSQPDMATIALEYLDTVIHCLNQ-NPGQFDSIASRFLTI-FDGMENNQFV 307
            :||:...||.............|  .:....|...||: .|..|..:..:...: .|..|..:.|
  Rat   738 KPSSKRTAADKDRGEEDADGSKT--QDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGV 800

  Fly   308 LSIAMEDIFEKSIEQPNFRYMGAKLYNLLHML----NSKPDSL--FHTLL--KCKLDYH------ 358
            :.:    ||||:|.:|||....|.:...|..|    ..||...  |..||  :|:.::.      
  Rat   801 IDL----IFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFEKDKDDD 861

  Fly   359 ------QEEVTKYMRSNEQQKVRE---------------TALFLAELYMQLRGDDDSRIQLIAVN 402
                  |:|:.:...:.|:.:::|               ...|:.||:         :::::...
  Rat   862 EVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELF---------KLKMLTEA 917

  Fly   403 IVYS-LSKLLASESNENVRCLCQTLKLAGYDLT-ADCPKDIQEIITALQAI--ELKSPGKYP-MA 462
            |::. :.|||.:...|::.|||:.|...|.||. |.....:.:....::.|  |.|:..:.. |.
  Rat   918 IMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFAKAKPRMDQYFNQMEKIIKEKKTSSRIRFML 982

  Fly   463 ASVIALQQNNWGRKVSNALGDDEDTVKEPPRLSDEPVFYGPDGRELTAEETDFLAGGDNDGDDDF 527
            ..|:.|:|:||                 .||..|:    ||.    |.::               
  Rat   983 QDVLDLRQSNW-----------------VPRRGDQ----GPK----TIDQ--------------- 1007

  Fly   528 DGDGADLEIDAEMDEETE 545
                  :..:|||:|..|
  Rat  1008 ------IHKEAEMEEHRE 1019

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 52/243 (21%)
Eif4g1XP_006248643.1 MIF4G 764..992 CDD:280935 52/240 (22%)
MA3 1241..1353 CDD:280933
W2_eIF4G1_like 1440..1569 CDD:211397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.