DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and ifg-1

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001368728.1 Gene:ifg-1 / 174322 WormBaseID:WBGene00002066 Length:1160 Species:Caenorhabditis elegans


Alignment Length:216 Identity:45/216 - (20%)
Similarity:78/216 - (36%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 APPQQQSRHQQYQQAGGAGG--GAPYGQQQPRYVNGFKHHHQQHHQQPHYNHHH-----NHQQKF 143
            |.|.|.|..|.........|  .:.| |:.|...:.:..:.||.:.||..||::     .|||::
 Worm    24 AVPMQDSSQQFVMPFVNTSGPVNSNY-QRMPMNQSAYPQYGQQQYNQPQTNHYYPPQAPQHQQQY 87

  Fly   144 NNDMQKLTNSVQNRLHLNSQQGSAGNYYQQQQVHQNTHHHQQHQQQHQPHNQHAKFQRHFHLNNS 208
                                    |.|.:....||...::||:|....|...|.:..     ...
 Worm    88 ------------------------GGYQRPDYGHQPQMYNQQYQGYQAPQQYHPEMP-----YQP 123

  Fly   209 FQQIVQQTQHNQPQQPHHQQH-----NQQQQQYIQNQNQQPQPSTSTAAASSSSSNSSQPDMATI 268
            .|...||..|..||:|..|:.     :...::.|:........:.:.||.::..:...:.....|
 Worm   124 AQPAQQQMTHTAPQEPKRQRKALEIVDPTTKKAIEVTPHLAPAAPAPAAPAAPIAPEEEKKKQNI 188

  Fly   269 ALEYLDTVIHCLNQNPGQFDS 289
            .||:|:.|.:.|:....:.|:
 Worm   189 TLEFLNQVKNELHHEDRRHDN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 6/20 (30%)
ifg-1NP_001368728.1 gliding_GltJ <231..343 CDD:411345
MIF4G 522..752 CDD:397130
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.