DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8963 and paip1

DIOPT Version :9

Sequence 1:NP_001163171.1 Gene:CG8963 / 36913 FlyBaseID:FBgn0034181 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_031753054.1 Gene:paip1 / 100038266 XenbaseID:XB-GENE-855781 Length:475 Species:Xenopus tropicalis


Alignment Length:420 Identity:94/420 - (22%)
Similarity:170/420 - (40%) Gaps:109/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 QTQHNQPQQPHHQQHNQQQQQYIQNQNQQPQPSTSTAAASSSSSNSSQ----------------- 262
            |.:.:.|.|.|...:....        .:.||:......|:.|:|:::                 
 Frog    86 QKRSSPPAQLHAHTYTMAV--------SKAQPADPGRLISNLSANAAEFYPSGYSVEANNCIEEN 142

  Fly   263 ------PDMATIALEYLDTVIHCLNQNPGQFDSIASRFLTIFDGMENNQFVLSIAMEDIFEKSIE 321
                  |: ||:| ||:...::.|.:.||.|::....|..:.:........|...:|.|::::..
 Frog   143 GCYPVLPE-ATLA-EYVQDFLNHLTEQPGSFEAEIFPFSDVLNHCVTTDESLQELVELIYQQATS 205

  Fly   322 QPNFRYMGAKLYNLL-HMLNSKPDS-LFHTLL--KCKLDYHQEEVTKYMRSNEQQKVRETALFLA 382
            .|||.|.||:|.|.| :.|:..|.: .|..||  :|..::.:...........:::.....|||.
 Frog   206 VPNFSYTGARLCNYLSNNLHINPQNHNFRQLLLKRCHTEFEKRNQAAKGDGATRKQFHAFVLFLG 270

  Fly   383 ELY--MQLRG--DDDSRIQLIAVNIVYSLSKLLASESNENVRCLCQTLKLAG------------- 430
            |||  ::::|  ...:|.:::...:...|:.|.::..::|:.|..:.|||.|             
 Frog   271 ELYLNLEIKGAKGQVTRAEILQSGLQELLNALFSNPVDDNLICAVKLLKLTGSVLEDAWKEKGLS 335

  Fly   431 -----------YDLTADCPKDIQEIITALQAIELKSPGKYPMAASVIALQQNNWGRKVSNALGDD 484
                       ..|.|:|.:|:::::  |:.:||:|               :||||..:.:...:
 Frog   336 CMEEVMQRMKNVVLDANCSRDVKQML--LKLVELRS---------------SNWGRVHAASTFKE 383

  Fly   485 EDTVKEPPRLSDEPVFYGPDGRELTAEETDFLA------------------GGDNDGD---DDFD 528
            .....:|....:||.||..:|...||.:.|:..                  |.|..||   :|||
 Frog   384 ATPENDPNYFMNEPTFYTSEGVPFTAADPDYQEKYQELLDREDYFGDYDENGTDGGGDPYFEDFD 448

  Fly   529 GDGADLEIDAEMDEETERAYKEFCKQGKQK 558
            .|      |.|||.|.|.||::||.:.:.|
 Frog   449 DD------DDEMDPEMEEAYEKFCLESEHK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8963NP_001163171.1 MIF4G 270..472 CDD:214713 49/233 (21%)
paip1XP_031753054.1 MIF4G 155..371 CDD:397130 49/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11670
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4709
Inparanoid 1 1.050 93 1.000 Inparanoid score I4940
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto105142
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5876
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.