DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ehbp1 and SMTN

DIOPT Version :9

Sequence 1:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_001369571.1 Gene:SMTN / 6525 HGNCID:11126 Length:1009 Species:Homo sapiens


Alignment Length:490 Identity:111/490 - (22%)
Similarity:180/490 - (36%) Gaps:107/490 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 STQQSFTLSLK-------------PVSKKITAASLELTISCVFLREGKATDEDMQSVVSMMSVNN 180
            |.:.:||:.:|             |...:....:|.|......|    :|....:|.::.:    
Human   550 SMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLL----STSSGGKSTITRV---- 606

  Fly   181 NDVAPLDDLEDIPDLDGFSEITDNFNDFTQQLEHMTTSLNGCIDVATPQSVPSLSEDPTPLAESF 245
            |....|..|..:..:..||...             .:|..||       |:...:|...|||.:.
Human   607 NSPGTLARLGSVTHVTSFSHAP-------------PSSRGGC-------SIKMEAEPAEPLAAAV 651

  Fly   246 NPLHFELDADGKREAANKLD---LPTAASGGSSGAEESLKTPNGLQHVVDQTPIKSPD------- 300
                         ||||..:   :..|..|.|..:.|.|.|... :.|:|:...:|.|       
Human   652 -------------EAANGAEQTRVNKAPEGRSPLSAEELMTIED-EGVLDKMLDQSTDFEERKLI 702

  Fly   301 -----EVKQPKQ--------------------------TPVESLRSKTNEDFDKMVTSTPLEPNV 334
                 |::|.|:                          |...:..|:...|...:.|.|..|..|
Human   703 RAALRELRQRKRDQRDKERERRLQEARGRPGEGRGNTATETTTRHSQRAADGSAVSTVTKTERLV 767

  Fly   335 NKDDVKPKKKRALFFTEKEDEQDLRVESVKEDT---TKTIGDNSTTKEKPK---EESQSSKDASS 393
            :.:|    ..|....|..|.....|.|:....|   |||...:|::|:...   .|.|:|..|.|
Human   768 HSND----GTRTARTTTVESSFVRRSENGSGSTMMQTKTFSSSSSSKKMGSIFDREDQASPRAGS 828

  Fly   394 VVVPSAKRPELQPLNLKKSYEPSQTPESAPVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKEN 458
            :.....::.|.:...:|....|..:...|........|..|:..|..|......:.....|...|
Human   829 LAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPRAAVQRSTSFGVPNAN 893

  Fly   459 TPGQDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGF 523
            :..|.||:||:..|:.|.:|.:.|.::||.:||||||::|:|.||..|..:||..:...|..:.|
Human   894 SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAF 958

  Fly   524 DAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQ 557
            .:||: ...|::::..||..|..||...|.||:.:
Human   959 SSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQE 993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345 8/48 (17%)
CH 460..562 CDD:237981 37/99 (37%)
DUF3585 <1027..1122 CDD:288945
SMTNNP_001369571.1 Smoothelin 86..128 CDD:403640
Smoothelin 167..216 CDD:403640
Smoothelin 664..713 CDD:403640 12/49 (24%)
CH_SMTNB 894..1005 CDD:409108 37/100 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.