DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ehbp1 and smtnl

DIOPT Version :9

Sequence 1:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_997970.1 Gene:smtnl / 399690 ZFINID:ZDB-GENE-040212-1 Length:493 Species:Danio rerio


Alignment Length:396 Identity:101/396 - (25%)
Similarity:153/396 - (38%) Gaps:91/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 FTQQLEHMTTSLNGCIDVATPQSVPSLSEDPTPLAESFNPLHFELDADGKREAANKLDLPTAASG 272
            |:.:.....||....|:...|..|     ||.|:.:...        :|...:.....:|...:.
Zfish   142 FSSRATFSVTSKTNSIERDEPIEV-----DPAPIPQGLE--------NGHLSSTENSIVPLRRNS 193

  Fly   273 GSSGA--EESLKTPNGLQH--------VVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFDKMVTS 327
            ..:|.  |.|...|..:.|        |.|.|.:|||:....|.|....::.       |.:.:|
Zfish   194 PPNGVLHEHSAPVPMAMPHLPITATTKVADSTVMKSPESPSSPMQATPSAIT-------DSLTSS 251

  Fly   328 TPLEPNVNKDDVKPKKKRALFFTEKEDEQDLRVESVK---EDTTKTIGDNSTTKEKPKEESQSSK 389
            .|:     ..|.:|:.:..:.          .|.|||   ....:|:|....|      |..||.
Zfish   252 PPV-----TSDNQPQLESPVH----------AVSSVKTWAPTPARTMGSPRLT------EKASSA 295

  Fly   390 DASSVVVPSAKRPELQPLNLKKSYEPSQTP----------------ESAPVPASVINESIGSCFS 438
            .|.||....     |.|.|..::.:   ||                .|..:|.::..::..|.|.
Zfish   296 PAKSVTYSG-----LFPHNTDRNVD---TPGDLSFGRGIERRRELVRSQTLPRNIGAQARRSIFE 352

  Fly   439 TSGSLNNSL-KPVE-KIVLKE---------NTPGQDLLEWCKEVTKDYPNVKVTNLTTSWRNGMA 492
            ...|.|||. |||: |..||.         ::..|.|||||:..|..|.|:.:.|.::||.:|||
Zfish   353 RLDSENNSRPKPVDSKPKLKRSQSFGVSSASSIKQILLEWCRSKTIGYQNIDIQNFSSSWSDGMA 417

  Fly   493 FCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAAE-SLGIPRVIEPRDMNML-TVPDKLAVMTYL 555
            |||::|.|.|...|.:.|:..:...|..:.|..|| ..|..|:||..||.:: ..||.:.|.||:
Zfish   418 FCALVHSFFPTEFDYNGLTPAERKHNFELAFSTAEKKAGCDRLIEVEDMMVMGRKPDPMCVFTYV 482

  Fly   556 HQLRAH 561
            ..|..|
Zfish   483 QSLYNH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345
CH 460..562 CDD:237981 40/104 (38%)
DUF3585 <1027..1122 CDD:288945
smtnlNP_997970.1 TolA_bind_tri 51..>90 CDD:292947
CH 386..490 CDD:237981 40/103 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.