DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ehbp1 and SMTNL2

DIOPT Version :9

Sequence 1:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_001108446.1 Gene:SMTNL2 / 342527 HGNCID:24764 Length:461 Species:Homo sapiens


Alignment Length:429 Identity:99/429 - (23%)
Similarity:158/429 - (36%) Gaps:133/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GKATDEDMQSVVSMMSVNNNDVAPLDDLEDIPDLDGFSEITDNFN----------DFTQQLEHM- 215
            |::.|.|..|...|...:|:.:............||..||..||:          ..:.:|.|. 
Human   132 GQSLDHDEASESEMRKTSNSCIMENGHQPGAGPGDGPPEIAQNFSAPDPPRPRPVSLSLRLPHQP 196

  Fly   216 TTSLNGCID---------VATPQSV-------PSLSEDPTPLAESFNPLHFELDADGKREAANKL 264
            .|::....|         ..:|.|.       ||.||..||...|          ..::.::...
Human   197 VTAITRVSDRFSGETSAAALSPMSAATLGGLNPSPSEVITPWTPS----------PSEKNSSFTW 251

  Fly   265 DLPTAASGGSSGAEESLKTPNGLQHVVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFDKMVTSTP 329
            .:|::..|..:.::.|...|     :|  ||.:||...:.|..|.|.....:..|    :|.|..
Human   252 SVPSSGYGAVTASKHSNSPP-----LV--TPPQSPVSPQPPAITQVHRQGERRRE----LVRSQT 305

  Fly   330 LEPNVNKDDVKPKKKRALFFTEKEDEQDLRVESVKEDTTKTIGDNSTTKEKPKEESQSSKDASSV 394
            | |..:    :.:.::|||  ||.:::                   |...|.|.|:::       
Human   306 L-PRTS----EAQARKALF--EKWEQE-------------------TAAGKGKGEARA------- 337

  Fly   395 VVPSAKRPELQPLNLKKSYEPSQTPESAPVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKENT 459
                         .||:|                  :|.|...::|              :|   
Human   338 -------------RLKRS------------------QSFGVASASS--------------IK--- 354

  Fly   460 PGQDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFD 524
              |.|||||:..|..|.:|.:.|.::||.:||||||::|.|.|:..|.:.||......|..:.|.
Human   355 --QILLEWCRSKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNSLSPTQRQKNFELAFT 417

  Fly   525 AAESL-GIPRVIEPRDMNML-TVPDKLAVMTYLHQLRAH 561
            .||:| ...|:||..||.:: ..||.:.|.||:..|..|
Human   418 MAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345 1/2 (50%)
CH 460..562 CDD:237981 41/104 (39%)
DUF3585 <1027..1122 CDD:288945
SMTNL2NP_001108446.1 SlyX <56..92 CDD:294687
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..193 12/60 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..307 14/58 (24%)
CH 354..458 CDD:237981 42/108 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.