DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ehbp1 and CG34417

DIOPT Version :9

Sequence 1:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_001259282.1 Gene:CG34417 / 31591 FlyBaseID:FBgn0085446 Length:5182 Species:Drosophila melanogaster


Alignment Length:601 Identity:119/601 - (19%)
Similarity:218/601 - (36%) Gaps:115/601 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWEPDMMNPLVGNISWPVPDNHTISVTLFKDPRTHELEDKDWTFVIE------------------ 103
            |.:..:|:....|.|....:|||......|:...:||..|....|:|                  
  Fly  4606 PLQNRVMSQQTLNSSIITSNNHTTVQKQQKEQHINELRRKSLGNVLESSQRSTYFEQEYKSSAPP 4670

  Fly   104 DVTPMGKKRVLANASINMRKYAS------IESTQQSFTLSLKPVSKKITAASLELTISCVFLREG 162
            |...:.|..:....:..::|:..      :.::.||..|:.:..|...|.:|..:..:.|..::.
  Fly  4671 DTPDIVKSSLPKEDAPLLKKFGPPQRHHYMPNSYQSPQLNKQGNSNSTTTSSTSVRSTTVVQQQH 4735

  Fly   163 KATDEDM--QSVVSMMSVNNNDVAPLDDLEDIPDLDGFSEITD----NFNDFTQQLEHMTTSLNG 221
            .......  .|:|...:.....|.|.|::......:..|..|.    |..:.:.|.....:.:|.
  Fly  4736 HQQQHQQIKPSIVETPATPQPQVPPEDEIPHNIVFNNVSAFTSMSRRNHEEDSHQGTQSGSRVNR 4800

  Fly   222 CIDVATPQSVPSLSEDPTPLAESFN-------------------PLHFELDADGKREAANKLDLP 267
            .....:...:..|.:...|....:|                   |..:|...|..:.:..:..:.
  Fly  4801 LSKCDSWNQICQLQQTAGPSPAKYNQPGSPGELRRTKSGHSLAVPKLYEAGIDKAQVSEKQRTVA 4865

  Fly   268 TAASGGSS---GAEESLK-----TPNGLQHVVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFD-- 322
            ...||..|   |..|.|:     |.:..:..:::|  |:.:::....:..:.||.:.:|.:..  
  Fly  4866 AYFSGQKSPTGGQVEELRTSMTTTTSSRKSAINRT--KTSEKLSAAARKSLSSLTTTSNGNVSTA 4928

  Fly   323 -----------------KMVTSTPLEPNV---------NKDDVKPKKKRALFFTEKEDEQDLRVE 361
                             ..::.:...|::         |.:|...:...|...:....||  |.|
  Fly  4929 GLGMVVRGGGVGGIGGGAALSRSATMPHIANLNLLDESNVEDAFEQLMMAQHKSSSSSEQ--RTE 4991

  Fly   362 SVKEDTTKTIGDNSTTKEKPKEESQSSKDASSVVVPSAKRPELQPLNLKKSYEPSQTPESAPVPA 426
            :..:|...|:   :||..|....:.|...||..:.|.||..:|.     |.....|..:|:|.. 
  Fly  4992 TKSKDGGATV---TTTTTKVTTRTVSGSAASKNISPLAKFKQLD-----KQAAAQQAQKSSPTT- 5047

  Fly   427 SVINESIGSCFSTSGSLNNSLKPVEKIV-----LKENTPGQDLLEWCKEVTKDYPNVKVTNLTTS 486
                       ||..:...|.:|:.|..     .:..|....||:|||..|::|.||::.|.::|
  Fly  5048 -----------STPTTPGGSAQPLFKFTDPALNARAATVKDQLLQWCKHKTQEYENVQINNFSSS 5101

  Fly   487 WRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAA-ESLGIPRVIEPRDMNMLTVPDKLA 550
            |.:|:||||:||||:|:..|.:.|:......|..:.|..| |..||..:::..||..::.||...
  Fly  5102 WSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKC 5166

  Fly   551 VMTYLHQLRAHFTGKQ 566
            |..|:..:...|...|
  Fly  5167 VFVYVQSIYRRFRNCQ 5182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345 23/131 (18%)
CH 460..562 CDD:237981 36/102 (35%)
DUF3585 <1027..1122 CDD:288945
CG34417NP_001259282.1 Smoothelin 2594..2636 CDD:289290
Smoothelin 3127..3176 CDD:289290
GBP_C <3810..3882 CDD:303769
coiled coil 3857..3868 CDD:293879
CH 5076..5179 CDD:237981 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.